Product Number |
OPCA02672 |
Product Page |
www.avivasysbio.com/gpc6-recombinant-protein-human-opca02672.html |
Name |
GPC6 Recombinant Protein (Human) (OPCA02672) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
59.6 kDa |
Tag |
N-terminal 6xHis-tagged |
NCBI Gene Id |
10082 |
Host |
Human |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
Yeast |
Gene Full Name |
glypican 6 |
Alias Symbols |
glypican proteoglycan 6;glypican-6;OMIMD1. |
Peptide Sequence |
DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS |
Product Format |
Liquid or Lyophilized powder |
Reference |
GPC6, a novel member of the glypican gene family, encodes a product structurally related to GPC4 and is colocalized with GPC5 on human chromosome 13.Paine-Saunders S., Viviano B.L., Saunders S.Genomics 57:455-458(1999) |
Description of Target |
Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases (By similarity). Enhances migration and invasion of cancer cells through WNT5A signaling. |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
Full Length of Mature Protein: DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS |
Datasheets/Manuals |
Printable datasheet for GPC6 Recombinant Protein (Human) (OPCA02672) (OPCA02672) |
Uniprot ID |
Q9Y625 |
Protein Name |
Glypican-6 |
Protein Accession # |
NP_005699.1
|
Purification |
Affinity purified using IMAC |
Nucleotide Accession # |
NM_005708.3 |
Gene Symbol |
GPC6 |
Predicted Species Reactivity |
Homo sapiens|Human |
Image 1 | Protein SDS-PAGE
 | GPC6 Recombinant Protein (Human) (OPCA02672) in SDS-PAGE showing the molecular weight of approximately 59.5 kDa. |
|
|