CCN5 Recombinant Protein (Mouse) (OPCA02559)

Data Sheet
 
Product Number OPCA02559
Product Page www.avivasysbio.com/ccn5-recombinant-protein-mouse-opca02559.html
Name CCN5 Recombinant Protein (Mouse) (OPCA02559)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 40.5 kDa
Tag N-terminal 6xHis-SUMO-tagged
NCBI Gene Id 22403
Host Mouse
Purity Greater than 90% as determined by SDS-PAGE.
Source E.coli
Gene Full Name cellular communication network factor 5
Protein Range 24-251 aa
Alias Symbols CCN;CCN family member 5;connective tissue growth factor-like protein;Crg;Crgr4;Ctgfl;CTGF-L;rC;Rcop1;Wi;Wisp2;WISP-2;WNT1 inducible signaling pathway protein 2.
Peptide Sequence QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Product Format Liquid or Lyophilized powder
Reference Identification and cloning of a connective tissue growth factor-like cDNA from human osteoblasts encoding a novel regulator of osteoblast functions.Kumar S., Hand A.T., Connor J.R., Dodds R.A., Ryan P.J., Trill J.J., Fisher S.M., Nuttall M.E., Lipshutz D.B., Zou C., Hwang S.M., Votta B.J., James I.E., Rieman D.J., Gowen M., Lee J.C.J. Biol. Chem. 274:17123-17131(1999)
Description of Target May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).
Reconstitution and Storage -20°C or -80°C
Protein Sequence QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Datasheets/Manuals Printable datasheet for CCN5 Recombinant Protein (Mouse) (OPCA02559) (OPCA02559)
Additional Information Relevance: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production .
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Uniprot ID Q9Z0G4
Protein Name WNT1-inducible-signaling pathway protein 2
Protein Accession # NP_058569.2
Nucleotide Accession # NM_016873.2
Gene Symbol Ccn5
Predicted Species Reactivity Mouse|Mus musculus
Image 1
Protein SDS-PAGE
Wisp2 Recombinant Protein (Mouse) (OPCA02559) in SDS-PAGE showing the molecular weight of approximately 40.5 kDa.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com