| Product Number |
OPCA02399 |
| Product Page |
www.avivasysbio.com/aadat-recombinant-protein-human-opca02399.html |
| Name |
AADAT Recombinant Protein (Human) (OPCA02399) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
60.2 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| NCBI Gene Id |
51166 |
| Host |
Human |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
aminoadipate aminotransferase |
| Protein Range |
30-425 aa |
| Alias Symbols |
2-aminoadipate aminotransferase;2-aminoadipate transaminase;alpha-aminoadipate aminotransferase;KAT/AadAT;KAT2;KATII;KYAT2;kynurenine aminotransferase II;kynurenine/alpha-aminoadipate aminotransferase, mitochondrial;kynurenine--oxoglutarate aminotransferase II;kynurenine--oxoglutarate transaminase 2;kynurenine--oxoglutarate transaminase II;L kynurenine/alpha aminoadipate aminotransferase. |
| Peptide Sequence |
PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Crystal structure of human kynurenine aminotransferase II, a drug target for the treatment of schizophrenia.Rossi F., Garavaglia S., Montalbano V., Walsh M.A., Rizzi M.J. Biol. Chem. 283:3559-3566(2008) |
| Description of Target |
Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro). |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL |
| Datasheets/Manuals |
Printable datasheet for AADAT Recombinant Protein (Human) (OPCA02399) (OPCA02399) |
| Additional Information |
Relevance: Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro). |
| Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
Q8N5Z0 |
| Protein Name |
Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial |
| Protein Accession # |
NP_001273611.1
|
| Nucleotide Accession # |
NM_001286682.1 |
| Gene Symbol |
AADAT |
| Predicted Species Reactivity |
Homo sapiens|Human |
| Image 1 | Protein SDS-PAGE
 | AADAT Recombinant Protein (Human) (OPCA02399) in SDS-PAGE showing the molecular weight of approximately 60.15 kDa. |
|
