Product Number |
OPCA02217 |
Product Page |
www.avivasysbio.com/fhit-recombinant-protein-mouse-opca02217.html |
Name |
FHIT Recombinant Protein (Mouse) (OPCA02217) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
21.1 kDa |
Tag |
N-terminal 6xHis-tagged |
NCBI Gene Id |
14198 |
Host |
Mouse |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
E.coli |
Gene Full Name |
fragile histidine triad gene |
Protein Range |
2-150 aa |
Alias Symbols |
AP3A hydrolase;AP3Aase;AW045638;bis(5'-adenosyl)-triphosphatase;diadenosine 5',5'''-P1,P3-triphosphate hydrolase;dinucleosidetriphosphatase;Fra1;Fra14A2;fragile histidine triad protein. |
Peptide Sequence |
SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA |
Product Format |
Liquid or Lyophilized powder |
Reference |
The murine Fhit locus isolation, characterization, and expression in normal and tumor cells.Pekarsky Y., Druck T., Cotticelli M.G., Ohta M., Shou J., Mendrola J., Montgomery J.C., Buchberg A.M., Siracusa L.D., Manenti G., Fong L.Y., Dragani T.A., Croce C.M., Huebner K.Cancer Res. 58:3401-3408(1998) |
Description of Target |
Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity (By similarity). Functions as tumor suppressor. |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA |
Datasheets/Manuals |
Printable datasheet for FHIT Recombinant Protein (Mouse) (OPCA02217) (OPCA02217) |
Additional Information |
Relevance: Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity . Functions as tumor suppressor. |
Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
O89106 |
Protein Name |
Bis(5'-adenosyl)-triphosphatase |
Protein Accession # |
NP_001295215.1
|
Nucleotide Accession # |
NM_001308286.1 |
Gene Symbol |
Fhit |
Predicted Species Reactivity |
Mouse|Mus musculus |
Image 1 | Protein SDS-PAGE
| Fhit Recombinant Protein (Mouse) (OPCA02217) in SDS-PAGE showing the molecular weight of approximately 21.2 kDa. |
|