Product Number |
OPCA02115 |
Product Page |
www.avivasysbio.com/ompc-recombinant-protein-escherichia-coli-opca02115.html |
Name |
OMPC Recombinant Protein (Escherichia coli) (OPCA02115) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
54.3 kDa |
Tag |
N-terminal 6xHis-SUMO-tagged |
NCBI Gene Id |
946716 |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
E.coli |
Gene Full Name |
outer membrane porin C |
Protein Range |
22-367aa |
Alias Symbols |
b2215;ECK2207;meoA;outer membrane porin C;Outer membrane protein 1B;par;Porin OmpC. |
Product Format |
Lyophilized 10mM Tris-HCl, 1mM EDTA (pH 8.0) |
Reference |
Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006) |
Description of Target |
Forms pores that allow passive diffusion of small molecules across the outer membrane. |
Reconstitution and Storage |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Protein Sequence |
Full Length of Mature Protein: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF |
Datasheets/Manuals |
Printable datasheet for OMPC Recombinant Protein (Escherichia coli) (OPCA02115) (OPCA02115) |
Uniprot ID |
P06996 |
Protein Name |
Outer membrane protein C |
Protein Accession # |
NP_416719.1
|
Purification |
Affinity purified using IMAC |
Nucleotide Accession # |
NC_000913.3 |
Gene Symbol |
ompC |
Predicted Species Reactivity |
Escherichia coli |
Image 1 | Protein SDS-PAGE
| ompC Recombinant Protein (Escherichia coli) (OPCA02115) in SDS-PAGE showing the molecular weight of approximately 54.28 kDa. |
|
|