OMPC Recombinant Protein (Escherichia coli) (OPCA02115)

Data Sheet
 
Product Number OPCA02115
Product Page www.avivasysbio.com/ompc-recombinant-protein-escherichia-coli-opca02115.html
Name OMPC Recombinant Protein (Escherichia coli) (OPCA02115)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 54.3 kDa
Tag N-terminal 6xHis-SUMO-tagged
NCBI Gene Id 946716
Purity Greater than 90% as determined by SDS-PAGE.
Source E.coli
Gene Full Name outer membrane porin C
Protein Range 22-367aa
Alias Symbols b2215;ECK2207;meoA;outer membrane porin C;Outer membrane protein 1B;par;Porin OmpC.
Product Format Lyophilized 10mM Tris-HCl, 1mM EDTA (pH 8.0)
Reference Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006)
Description of Target Forms pores that allow passive diffusion of small molecules across the outer membrane.
Reconstitution and Storage We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Protein Sequence Full Length of Mature Protein: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Datasheets/Manuals Printable datasheet for OMPC Recombinant Protein (Escherichia coli) (OPCA02115) (OPCA02115)
Uniprot ID P06996
Protein Name Outer membrane protein C
Protein Accession # NP_416719.1
Purification Affinity purified using IMAC
Nucleotide Accession # NC_000913.3
Gene Symbol ompC
Predicted Species Reactivity Escherichia coli
Image 1
Protein SDS-PAGE
ompC Recombinant Protein (Escherichia coli) (OPCA02115) in SDS-PAGE showing the molecular weight of approximately 54.28 kDa.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com