Product Number |
OPCA02041 |
Product Page |
www.avivasysbio.com/aap1-recombinant-protein-baker-s-yeast-opca02041.html |
Name |
AAP1 Recombinant Protein (Baker's yeast) (OPCA02041) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
60.8 kDa |
Tag |
N-terminal 6xHis-SUMO-tagged |
NCBI Gene Id |
856443 |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
E.coli |
Gene Full Name |
arginine/alanine aminopeptidase |
Protein Range |
1-389 aa |
Alias Symbols |
AAP1';arginine/alanine aminopeptidase;YHR047C. |
Peptide Sequence |
MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG |
Product Format |
Liquid or Lyophilized powder |
Reference |
Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003) |
Description of Target |
Positive effector of glycogen accumulation. May be involved in nutrient-sensing. |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG |
Datasheets/Manuals |
Printable datasheet for AAP1 Recombinant Protein (Baker's yeast) (OPCA02041) (OPCA02041) |
Additional Information |
Relevance: Positive effector of glycogen accumulation. May be involved in nutrient-sensing. |
Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P37898 |
Protein Name |
Alanine/arginine aminopeptidase |
Protein Accession # |
NP_011913.1
|
Nucleotide Accession # |
NM_001179177.1 |
Gene Symbol |
AAP1 |
Predicted Species Reactivity |
Saccharomyces cerevisiae |
Image 1 | Protein SDS-PAGE
| AAP1 Recombinant Protein (Yeast) (OPCA02041) in SDS-PAGE showing the molecular weight of approximately 60.73 kDa. |
|