AAP1 Recombinant Protein (Baker's yeast) (OPCA02041)

Data Sheet
 
Product Number OPCA02041
Product Page www.avivasysbio.com/aap1-recombinant-protein-baker-s-yeast-opca02041.html
Name AAP1 Recombinant Protein (Baker's yeast) (OPCA02041)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 60.8 kDa
Tag N-terminal 6xHis-SUMO-tagged
NCBI Gene Id 856443
Host Yeast
Purity Greater than 90% as determined by SDS-PAGE.
Source E.coli
Gene Full Name arginine/alanine aminopeptidase
Protein Range 1-389 aa
Alias Symbols AAP1';arginine/alanine aminopeptidase;YHR047C.
Peptide Sequence MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG
Product Format Liquid or Lyophilized powder
Reference Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003)
Description of Target Positive effector of glycogen accumulation. May be involved in nutrient-sensing.
Reconstitution and Storage -20°C or -80°C
Protein Sequence MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG
Datasheets/Manuals Printable datasheet for AAP1 Recombinant Protein (Baker's yeast) (OPCA02041) (OPCA02041)
Additional Information Relevance: Positive effector of glycogen accumulation. May be involved in nutrient-sensing.
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Uniprot ID P37898
Protein Name Alanine/arginine aminopeptidase
Protein Accession # NP_011913.1
Nucleotide Accession # NM_001179177.1
Gene Symbol AAP1
Predicted Species Reactivity Saccharomyces cerevisiae
Image 1
Protein SDS-PAGE
AAP1 Recombinant Protein (Yeast) (OPCA02041) in SDS-PAGE showing the molecular weight of approximately 60.73 kDa.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com