Product Number |
OPCA02037 |
Product Page |
www.avivasysbio.com/ampc-recombinant-protein-pseudomonas-aeruginosa-opca02037.html |
Name |
AMPC Recombinant Protein (Pseudomonas aeruginosa) (OPCA02037) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
56.7 kDa |
Tag |
N-terminal 6xHis-SUMO-tagged |
NCBI Gene Id |
878149 |
Host |
Pseudomonas aeruginosa |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
E.coli |
Gene Full Name |
beta-lactamase |
Protein Range |
27-397 aa |
Alias Symbols |
beta-lactamase;Cephalosporinase;PA4110. |
Peptide Sequence |
GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR |
Product Format |
Liquid or Lyophilized powder |
Reference |
Cloning, sequencing and analysis of the structural gene and regulatory region of the Pseudomonas aeruginosa chromosomal ampC beta-lactamase.Lodge J.M., Minchin S.D., Piddock L.J.V., Busby S.J.W.Biochem. J. 272:627-631(1990) |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR |
Datasheets/Manuals |
Printable datasheet for AMPC Recombinant Protein (Pseudomonas aeruginosa) (OPCA02037) (OPCA02037) |
Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P24735 |
Protein Name |
Beta-lactamase |
Protein Accession # |
NP_252799.1
|
Nucleotide Accession # |
NC_002516.2 |
Gene Symbol |
ampC |
Predicted Species Reactivity |
Pseudomonas aeruginosa |
Image 1 | Protein SDS-PAGE
| ampC Recombinant Protein (Pseudomonas aeruginosa) (OPCA02037) in SDS-PAGE showing the molecular weight of approximately 56.65 kDa. |
|
|