Product Number |
OPCA01455 |
Product Page |
www.avivasysbio.com/aif1-recombinant-protein-rat-opca01455.html |
Name |
AIF1 Recombinant Protein (Rat) (OPCA01455) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
32.7 kDa |
Tag |
N-terminal 6xHis-SUMO-tagged |
NCBI Gene Id |
29427 |
Host |
Rat |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
E.coli |
Gene Full Name |
allograft inflammatory factor 1 |
Protein Range |
2-147 aa |
Alias Symbols |
AIF-1;allograft inflammatory factor 1;balloon angioplasty responsive transcript;balloon angioplasty-responsive transcript 1;Bart1;BART-1;iba1;ionized calcium binding adapter molecule 1;Ionized calcium-binding adapter molecule 1;microglia response factor;mrf-1;protein BART-1. |
Peptide Sequence |
SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP |
Product Format |
Liquid or Lyophilized powder |
Reference |
The genomic sequence and comparative analysis of the rat major histocompatibility complex.Hurt P., Walter L., Sudbrak R., Klages S., Mueller I., Shiina T., Inoko H., Lehrach H., Guenther E., Reinhardt R., Himmelbauer H.Genome Res. 14:631-639(2004) |
Description of Target |
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity). |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP |
Datasheets/Manuals |
Printable datasheet for AIF1 Recombinant Protein (Rat) (OPCA01455) (OPCA01455) |
Additional Information |
Relevance: Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation . |
Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P55009 |
Protein Name |
Allograft inflammatory factor 1 |
Protein Accession # |
NP_058892.1
|
Nucleotide Accession # |
NM_017196.3 |
Gene Symbol |
Aif1 |
Predicted Species Reactivity |
Rat|Rattus norvegicus |
Image 1 | Protein SDS-PAGE
 | Aif1 Recombinant Protein (Rat) (OPCA01455) in SDS-PAGE showing the molecular weight of approximately 32.69 kDa. |
|