AIF1 Recombinant Protein (Rat) (OPCA01455)

Data Sheet
 
Product Number OPCA01455
Product Page www.avivasysbio.com/aif1-recombinant-protein-rat-opca01455.html
Name AIF1 Recombinant Protein (Rat) (OPCA01455)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 32.7 kDa
Tag N-terminal 6xHis-SUMO-tagged
NCBI Gene Id 29427
Host Rat
Purity Greater than 90% as determined by SDS-PAGE.
Source E.coli
Gene Full Name allograft inflammatory factor 1
Protein Range 2-147 aa
Alias Symbols AIF-1;allograft inflammatory factor 1;balloon angioplasty responsive transcript;balloon angioplasty-responsive transcript 1;Bart1;BART-1;iba1;ionized calcium binding adapter molecule 1;Ionized calcium-binding adapter molecule 1;microglia response factor;mrf-1;protein BART-1.
Peptide Sequence SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
Product Format Liquid or Lyophilized powder
Reference The genomic sequence and comparative analysis of the rat major histocompatibility complex.Hurt P., Walter L., Sudbrak R., Klages S., Mueller I., Shiina T., Inoko H., Lehrach H., Guenther E., Reinhardt R., Himmelbauer H.Genome Res. 14:631-639(2004)
Description of Target Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity).
Reconstitution and Storage -20°C or -80°C
Protein Sequence SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
Datasheets/Manuals Printable datasheet for AIF1 Recombinant Protein (Rat) (OPCA01455) (OPCA01455)
Additional Information Relevance: Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation .
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Uniprot ID P55009
Protein Name Allograft inflammatory factor 1
Protein Accession # NP_058892.1
Nucleotide Accession # NM_017196.3
Gene Symbol Aif1
Predicted Species Reactivity Rat|Rattus norvegicus
Image 1
Protein SDS-PAGE
Aif1 Recombinant Protein (Rat) (OPCA01455) in SDS-PAGE showing the molecular weight of approximately 32.69 kDa.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com