| Product Number |
OPCA01437 |
| Product Page |
www.avivasysbio.com/fcgrt-recombinant-protein-crab-eating-macaque-opca01437.html |
| Name |
FCGRT Recombinant Protein (Crab-eating macaque) (OPCA01437) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
46.4 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| NCBI Gene Id |
102128913 |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Gene Full Name |
Fc fragment of IgG receptor and transporter |
| Protein Range |
24-297 aa |
| Alias Symbols |
Fc fragment of IgG, receptor, transporter, alpha;Fcrn;IgG Fc fragment receptor transporter alpha chain;IgG receptor FcRn large subunit p51;Neonatal Fc receptor. |
| Peptide Sequence |
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Binding of human IgG to cynomolgus FcR.Namenuk A.K., Hong K., Meng Y.G., Shields R.L., Cromwell M.E.M., Presta L.G. |
| Description of Target |
Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity). Possible role in transfer of immunoglobulin G from mother to fetus (By similarity). |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS |
| Datasheets/Manuals |
Printable datasheet for FCGRT Recombinant Protein (Crab-eating macaque) (OPCA01437) (OPCA01437) |
| Additional Information |
Product Info: His tagged
Tag Info: His-SUMO-tag
Sequence Info: Extracellular domain |
| Additional Information |
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
| Additional Information |
Expression Region: 24-297aa |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
Q8SPV9 |
| Protein Name |
IgG receptor FcRn large subunit p51 |
| Gene Symbol |
FCGRT |
| Predicted Species Reactivity |
Cynomolgus Monkey|Macaca fascicularis |
| Application |
ELISA, WB, SDS-PAGE |
| Predicted Homology Based on Immunogen Sequence |
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Image 1 | |
