Product Number |
OPCA01216 |
Product Page |
www.avivasysbio.com/calr-recombinant-protein-mouse-opca01216.html |
Name |
CALR Recombinant Protein (Mouse) (OPCA01216) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
48.3 kDa |
Tag |
N-terminal 6xHis-tagged |
NCBI Gene Id |
12317 |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
Yeast |
Gene Full Name |
calreticulin |
Protein Range |
18-416 aa |
Alias Symbols |
Calregulin;calreticulin;CR;CRP55;CRT;endoplasmic reticulum resident protein 60;ERp60;HACBP. |
Peptide Sequence |
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL |
Product Format |
Liquid or Lyophilized powder |
Reference |
Structural and functional relationships between the lectin and arm domains of calreticulin.Pocanschi C.L., Kozlov G., Brockmeier U., Brockmeier A., Williams D.B., Gehring K.J. Biol. Chem. 286:27266-27277(2011) |
Description of Target |
Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity). |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL |
Datasheets/Manuals |
Printable datasheet for CALR Recombinant Protein (Mouse) (OPCA01216) (OPCA01216) |
Additional Information |
Tag information : His tag
|
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P14211 |
Protein Name |
Calreticulin |
Gene Symbol |
Calr |
Predicted Species Reactivity |
Mouse|Mus musculus |
Image 1 | |
|