| Product Number |
OPCA01063 |
| Product Page |
www.avivasysbio.com/prf-recombinant-protein-toxoplasma-gondii-opca01063.html |
| Name |
PRF Recombinant Protein (Toxoplasma gondii) (OPCA01063) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
21.4 kDa |
| Tag |
N-terminal 6xHis-tagged |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Protein Range |
2-163 aa |
| Peptide Sequence |
SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Structure-based analysis of Toxoplasma gondii profilin a parasite-specific motif is required for recognition by Toll-like receptor 11.Kucera K., Koblansky A.A., Saunders L.P., Frederick K.B., De La Cruz E.M., Ghosh S., Modis Y.J. Mol. Biol. 403:616-629(2010) |
| Description of Target |
Binds to proline rich sequences in various regulatory formin-like proteins and also to membrane phospholipids. Binds to actin and affects the structure of the cytoskeleton. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Datasheets/Manuals |
Printable datasheet for PRF Recombinant Protein (Toxoplasma gondii) (OPCA01063) (OPCA01063) |
| Additional Information |
Tag information : His tag
|
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
Q58NA1 |
| Protein Name |
Profilin |
| Gene Symbol |
PRF |
| Predicted Species Reactivity |
Toxoplasma gondii |
| Image 1 | PRF Recombinant Protein (Toxoplasma gondii) (OPCA01063)
 | |
|
|
