Product Number |
OPCA01014 |
Product Page |
www.avivasysbio.com/abp1-recombinant-protein-maize-opca01014.html |
Name |
ABP1 Recombinant Protein (Maize) (OPCA01014) |
Protein Size (# AA) |
Recombinant amino acids |
Molecular Weight |
22.4 kDa |
Tag |
N-terminal 6xHis-tagged |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Source |
E.coli |
Protein Range |
39-201 aa |
Alias Symbols |
ERABP1. |
Peptide Sequence |
SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL |
Product Format |
Liquid or Lyophilized powder |
Reference |
Molecular analysis of three maize 22KDA auxin-binding protein genes -- transient promoter expression and regulatory regions.Schwob E., Choi S.-Y., Simmons C., Migliaccio F., Ilag L., Hesse T., Palme K., Soell D.Plant J. 4:423-432(1993) |
Description of Target |
Receptor for the plant hormone auxin. |
Reconstitution and Storage |
-20°C or -80°C |
Protein Sequence |
SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL |
Datasheets/Manuals |
Printable datasheet for ABP1 Recombinant Protein (Maize) (OPCA01014) (OPCA01014) |
Additional Information |
Tag information : His tag
|
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Uniprot ID |
P13689 |
Protein Name |
Auxin-binding protein 1 |
Gene Symbol |
ABP1 |
Predicted Species Reactivity |
Zea mays |
Image 1 | ABP1 Recombinant Protein (Maize) (OPCA01014)
 | |
|
|