ABP1 Recombinant Protein (Maize) (OPCA01014)

Data Sheet
 
Product Number OPCA01014
Product Page www.avivasysbio.com/abp1-recombinant-protein-maize-opca01014.html
Name ABP1 Recombinant Protein (Maize) (OPCA01014)
Protein Size (# AA) Recombinant amino acids
Molecular Weight 22.4 kDa
Tag N-terminal 6xHis-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Source E.coli
Protein Range 39-201 aa
Alias Symbols ERABP1.
Peptide Sequence SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL
Product Format Liquid or Lyophilized powder
Reference Molecular analysis of three maize 22KDA auxin-binding protein genes -- transient promoter expression and regulatory regions.Schwob E., Choi S.-Y., Simmons C., Migliaccio F., Ilag L., Hesse T., Palme K., Soell D.Plant J. 4:423-432(1993)
Description of Target Receptor for the plant hormone auxin.
Reconstitution and Storage -20°C or -80°C
Protein Sequence SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL
Datasheets/Manuals Printable datasheet for ABP1 Recombinant Protein (Maize) (OPCA01014) (OPCA01014)
Additional Information Tag information : His tag
Storage Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Uniprot ID P13689
Protein Name Auxin-binding protein 1
Gene Symbol ABP1
Predicted Species Reactivity Zea mays
Image 1
ABP1 Recombinant Protein (Maize) (OPCA01014)
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com