| Product Number |
OPCA00283 |
| Product Page |
www.avivasysbio.com/recombinant-parvalbumin-beta-protein-baltic-cod-opca00283.html |
| Name |
Recombinant Parvalbumin Beta Protein (Baltic cod) (OPCA00283) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
16.1 kDa |
| Tag |
N-terminal 6xHis-tagged |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Alias Symbols |
Allergen Gad c I;Allergen M. |
| Peptide Sequence |
AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
The primary structure of allergen M from cod.Elsayed S., Bennich H.Scand. J. Immunol. 4:203-208(1975) |
| Description of Target |
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
Full Length: AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG |
| Datasheets/Manuals |
Printable datasheet for Recombinant Parvalbumin Beta Protein (Baltic cod) (OPCA00283) (OPCA00283) |
| Uniprot ID |
P02622 |
| Protein Name |
Parvalbumin beta |
| Purification |
Affinity purified using IMAC |
| Predicted Species Reactivity |
Atlantic Cod|Gadus morhua |
| Image 1 | |
|
