| Product Number |
OACA02358 |
| Product Page |
www.avivasysbio.com/rabbit-anti-human-sarcolipin-oaca02358.html |
| Name |
Rabbit anti-human sarcolipin (OACA02358) |
| Isotype |
IgG |
| NCBI Gene Id |
100009246 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
Varies by lot. See vial for exact concentration. |
| Alias Symbols |
sarcolipin, SLN, MGC12301, MGC125854, MGC125855 |
| Product Format |
Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3 |
| Description of Target |
Sarcoplasmic reticulum Ca(2+)-ATPases are transmembrane proteins that catalyze the ATP-dependent transport of Ca(2+) from the cytosol into the lumen of the sarcoplasmic reticulum in muscle cells. This gene encodes a small proteolipid that regulates several sarcoplasmic reticulum Ca(2+)-ATPases. The transmembrane protein interacts with Ca(2+)-ATPases and reduces the accumulation of Ca(2+) in the sarcoplasmic reticulum without affecting the rate of ATP hydrolysis. |
| Reconstitution and Storage |
Upon receipt store at -20C or -80C. Avoid freeze/thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for Rabbit anti-human sarcolipin (OACA02358)OACA02358 |
| Additional Information |
Subcellular Location: Sarcoplasmic reticulum membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein. |
| Immunogen |
Human SLN (1-31aa): MGINTRELFLNFTIVLITVILMWLLVRSYQY |
| Uniprot ID |
P42532 |
| Protein Accession # |
NP_001075856.1 |
| Purification |
Antigen affinity purified |
| Gene Symbol |
SLN |
| Predicted Species Reactivity |
Human, Mouse, Rat |
| Application |
WB |
| Image 1 | human heart
 | Sample: human heart tissue;
Primary Antibody Dilution: 1:500
|
|
|
