ROCK2 Antibody (OABB01870)

• Product Number: OABB01870
• Name: ROCK2 Antibody (OABB01870)
• Molecular Weight: 160900 MW
• Clone: Polyclonal
• Isotype: Rabbit IgG
• NCBI Gene Id: 9475
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 500 ug/ml
• Gene Full Name: Rho associated coiled-coil containing protein kinase 2
• Description: Rabbit IgG polyclonal antibody for Rho-associated protein kinase 2(ROCK2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
• Alias Symbols: p164 ROCK-2;Rho kinase 2;rho-associated protein kinase 2;Rho-associated, coiled-coil-containing protein kinase 2;rho-associated, coiled-coil-containing protein kinase II;ROCK-II.
• Peptide Sequence: Synthetic peptide located within the following region: EEDLKNGKILLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQKKQELQDERDSLAAQLEITLTKAD
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Reference: 1. Takahashi, N.; Tuiki, H.; Saya, H.; Kaibuchi, K. : Localization of the gene coding for ROCK II/Rho kinase on human chromosome 2p24. Genomics 55: 235-237, 1999.
  2. Thumkeo, D.; Keel, J.; Ishizaki, T.; Hirose, M.; Nonomura, K.; Oshima, H.; Oshima, M.; Taketo, M. M.; Narumiya, S. : Targeted disruption of the mouse Rho-associated kinase 2 gene results in intrauterine growth retardation and fetal death. Molec. Cell. Biol. 23: 5043-5055, 2003.
  
• Description of Target: Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays an important role in generating the circadian rhythm of the aortic myofilament Ca(2+) sensitivity and vascular contractility by modulating the myosin light chain phosphorylation.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Specificity: No cross reactivity with other proteins.
• Additional Information: Notes: WB: The detection limit for ROCK2 is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  
• Additional Information: Background: Rho-associated kinase (ROCK), including the ROCK-I and ROCK-II isoforms, is a protein kinase involved in signaling from Rho to actin cytoskeleton. Serine/threonine kinase ROCK II/Rho kinase, which is an isozyme of ROCK I, is one of the targets for the small GTPase Rho. ROCK II regulates the formation of actin stress fibers and focal adhesions, cytokinesis, smooth muscle contraction, and the activation of c-fos serum response element. Sequencing analysis has shown that human ROCK II contains 1388 amino acid residues with a calculated molecular mass of approximately 161 kDa. Fluorescence in situ hybridization analysis showed that the human ROCK II gene is located on chromosome 2p24. Thumkeo et al. concluded that ROCK-II is essential in inhibiting blood coagulation and maintaining blood flow in the endothelium-free labyrinth layer and that loss of ROCK-II leads to thrombus formation, placental dysfunction, intrauterine growth retardation, and fetal death.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Mouse, Rat
  Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat
• Immunogen: E.coli-derived human ROCK2 recombinant protein (Position: E652-D923). Human ROCK2 shares 94.9% and 95.2% amino acid (aa) sequence identity with mouse and rat ROCK2, respectively.
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Uniprot ID: O75116
• Protein Name: Rho-associated protein kinase 2
• Purification: Affinity Purified
• Tested Species Reactivity: Human, Mouse, Rat
• Gene Symbol: ROCK2
• Predicted Species Reactivity: Human|Mouse|Rat
• Application: Immunohistochemistry|Western blot
• Image 1: Human Mammary Cancer Tissue
  
  Anti-ROCK2 Picoband antibody, OABB01870, IHC(P)
  IHC(P): Human Mammary Cancer Tissue
• Image 2: Mouse Cardiac Muscle Tissue
  
  Anti-ROCK2 Picoband antibody, OABB01870, IHC(P)
  IHC(P): Mouse Cardiac Muscle Tissue
• Image 3: Rat Brain Tissue
  
  Anti-ROCK2 Picoband antibody, OABB01870, IHC(P)
  IHC(P): Rat Brain Tissue
• Image 4: Rat Brain Tissue Lysate, Rat Liver Tissue Lysate, HELA Whole Cell Lysate, CEM Whole Cell Lysate, A549 Whole Cell Lysate, MCF-7 Whole Cell Lysate
  
  Anti-ROCK2 Picoband antibody, OABB01870, Western blotting
  All lanes: Anti ROCK2 (OABB01870) at 0.5ug/ml
  Lane 1: Rat Brain Tissue Lysate at 50ug
  Lane 2: Rat Liver Tissue Lysate at 50ug
  Lane 3: HELA Whole Cell Lysate at 40ug
  Lane 4: CEM Whole Cell Lysate at 40ug
  Lane 5: A549 Whole Cell Lysate at 40ug
  Lane 6: MCF-7 Whole Cell Lysate at 40ug
  Predicted bind size: 161KD
  Observed bind size: 161KD