TRKB Antibody (OABB01861)

• Product Number: OABB01861
• Name: TRKB Antibody (OABB01861)
• Clone: Polyclonal
• Isotype: Rabbit IgG
• NCBI Gene Id: 4915
• Host: Rabbit
• Clonality: Polyclonal
• Gene Full Name: neurotrophic tyrosine kinase, receptor, type 2
• Description: Rabbit IgG polyclonal antibody for BDNF/NT-3 growth factors receptor(NTRK2) detection. Tested with WB in Human;Mouse;Rat.
• Alias Symbols: AI848316, BDNF tropomyosine receptor kinase B, BDNF/NT 3 growth factors receptor, BDNF/NT-3 growth factors receptor, Brain derived neurotrophic factor receptor, C030027L06Rik, EC 2.7.10.1, GP145 TrkB, GP145-TrkB, GP145-TrkB/GP95-TrkB, GP95 TrkB, Neurotrophic tyrosine kinase receptor type 2, Neurotrophin receptor tyrosine kinase type 2, NTRK 2, NTRK2, NTRK2_HUMAN, Obesity, hyperphagia, and developmental delay, included, RATTRKB1, Tkrb, Trk B, Trk-B, TRKB, TrkB tyrosine kinase, TRKB1, Tropomyosin related kinase B, tyrosine kinase receptor B, Tyrosine receptor kinase B
• Peptide Sequence: Synthetic peptide located within the following region: ENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNE
• Product Format: Lyophilized
• Reference: 1. Berghuis, P., Dobszay, M. B., Wang, X., Spano, S., Ledda, F., Sousa, K. M., Schulte, G., Ernfors, P., Mackie, K., Paratcha, G., Hurd, Y. L., Harkany, T. Endocannabinoids regulate interneuron migration and morphogenesis by transactivating the TrkB receptor. Proc. Nat. Acad. Sci. 102: 19115-19120, 2005.
  2. Luberg, K., Wong, J., Weickert, C. S., Timmusk, T. Human TrkB gene: novel alterative transcripts, protein isoforms and expression pattern in the prefrontal cerebral cortex during postnatal development. J. Neurochem. 113: 952-964, 2010.
  3. Nikoletopoulou, V., Lickert, H., Frade, J. M., Rencurel, C., Giallonardo, P., Zhang, L., Bibel, M., Barde, Y.-A. Neurotrophin receptors TrkA and TrkC cause neuronal death whereas TrkB does not. Nature 467: 59-63, 2010.
  
• Description of Target: TrkB is also known as NTRK2. This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants. Tropomyosin receptor kinase B is the high affinity catalytic receptor for several "neurotrophins", which are small protein growth factors that induce the survival and differentiation of distinct cell populations. The neurotrophins that activate TrkB are: BDNF (Brain Derived Neurotrophic Factor), neurotrophin-4 (NT-4), and neurotrophin-3 (NT-3). As such, TrkB mediates the multiple effects of these neurotrophic factors, which includes neuronal differentiation and survival.
• Reconstitution and Storage: Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.. At -20C for one year from date of receipt. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for six months. Avoid repeated freezing and thawing.
• Specificity: No cross reactivity with other proteins.
• Additional Information: Notes: WB: The detection limit for TrkB is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  Predicted Species: Species predicted to be fit for the product based on sequence similarities.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  
• Additional Information: Background: TrkB is also known as NTRK2. This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants. Tropomyosin receptor kinase B is the high affinity catalytic receptor for several "neurotrophins", which are small protein growth factors that induce the survival and differentiation of distinct cell populations. The neurotrophins that activate TrkB are: BDNF (Brain Derived Neurotrophic Factor), neurotrophin-4 (NT-4), and neurotrophin-3 (NT-3). As such, TrkB mediates the multiple effects of these neurotrophic factors, which includes neuronal differentiation and survival.
• Application Info: Western blot: 0.1-0.5 ug/ml: Mouse, Rat: Human
• Immunogen: E.coli-derived human TrkB recombinant protein (Position: E66-E242). Human TrkB shares 91.5% and 89.8% amino acid (aa) sequence identity with mouse and rat TrkB, respectively.
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Uniprot ID: Q16620
• Protein Name: BDNF/NT-3 growth factors receptor
• Purification: Immunogen affinity purified.
• Tested Species Reactivity: Mouse, Rat
• Gene Symbol: NTRK2
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human
• Image 1: Rat Brain Tissue Lysate, Mouse Brain Tissue Lysate
  
  Anti-TrkB Picoband antibody, OABB01861, Western blotting
  All lanes: Anti TrkB (OABB01861) at 0.5ug/ml
  Lane 1: Rat Brain Tissue Lysate at 50ug
  Lane 2: Mouse Brain Tissue Lysate at 50ug
  Predicted bind size: 92KD
  Observed bind size: 120KD