| Product Number |
OAAN00307 |
| Product Page |
www.avivasysbio.com/il7r-antibody-oaan00307.html |
| Name |
IL7R Antibody (OAAN00307) |
| Molecular Weight |
52 kDa |
| Isotype |
IgG |
| Conjugation |
Unconjugated |
| NCBI Gene Id |
3575 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Gene Full Name |
interleukin 7 receptor |
| Alias Symbols |
ILRA, CD127, IL7RA, CDW127, IL-7R-alpha |
| Peptide Sequence |
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD |
| Product Format |
Liquid PBS with 0.02% sodium azide and 50% glycerol (pH 7.3) |
| Description of Target |
The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found. |
| Reconstitution and Storage |
Store at -20°C. Avoid repeated freeze/thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IL7R (OAAN00307) |
| Additional Information |
Positive Samples: A-549, HT-29, Mouse thymus, Mouse lung, Rat thymus
Cellular Location: Cell membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein |
| Application Info |
WB: 1:500~2000
IF: 1:20~50 |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human CD127/IL7R (NP_002176.2). |
| Uniprot ID |
P16871 |
| Protein Name |
Interleukin-7 receptor subunit alpha |
| Protein Accession # |
NP_002176.2 |
| Purification |
Affinity purified against immunogen |
| Nucleotide Accession # |
NM_002185.3 |
| Gene Symbol |
IL7R |
| Predicted Species Reactivity |
Human, Mouse, Rat |
| Application |
WB, IF |
| Image 1 | Multiple Cell Lines
 | Western blot analysis of extracts of various cell lines, using IL7R antibody. |
| | Image 2 | Human Esophagus
 | Immunohistochemistry of paraffin-embedded human esophageal using IL7R antibody at dilution of 1:100 (40x lens). |
| | Image 3 | HeLa Cells,Human Esophagus,Multiple Cell Lines
 | Immunofluorescence analysis of HeLa cell using IL7R antibody. |
|
|
