| Product Number |
OAAL00865 |
| Product Page |
www.avivasysbio.com/ubash3b-antibody-oaal00865.html |
| Name |
UBASH3B Antibody (OAAL00865) |
| Clone |
3G7 |
| Isotype |
IgG2b Kappa |
| NCBI Gene Id |
84959 |
| Host |
Mouse |
| Clonality |
Monoclonal |
| Gene Full Name |
ubiquitin associated and SH3 domain containing B |
| Alias Symbols |
cbl-interacting protein p70;Cbl-interacting protein Sts-1;nm23-phosphorylated unknown substrate;p70;SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling 1, nm23-phosphorylated unknown substrate;STS1;STS-1;suppressor of T-cell receptor signaling 1;T-cell ubiquitin ligand 2;TULA2;TULA-2;tyrosine-protein phosphatase STS1/TULA2;ubiquitin-associated and SH3 domain-containing protein B. |
| Peptide Sequence |
DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI |
| Product Format |
Liquid |
| Description of Target |
This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq |
| Reconstitution and Storage |
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Datasheets/Manuals |
Printable datasheet for UBASH3B Antibody (OAAL00865) |
| Immunogen |
UBASH3B (NP_116262.2, 344 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Formulation |
In 1x PBS, pH 7.4 |
| Protein Name |
Homo sapiens ubiquitin associated and SH3 domain containing B (UBASH3B), mRNA|ubiquitin-associated and SH3 domain-containing protein B [Homo sapiens] |
| Protein Accession # |
https://www.ncbi.nlm.nih.gov/protein/NP_116262.2 |
| Nucleotide Accession # |
https://www.ncbi.nlm.nih.gov/nuccore/NM_032873 |
| Gene Symbol |
UBASH3B |
| Predicted Species Reactivity |
Human, Mouse |
| Application |
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
| Image 1 | Recombinant GST tagged UBASH3B
 | Detection limit for recombinant GST tagged UBASH3B is 1 ng/ml as a capture antibody. |
| | Image 2 | HeLa cell
 | Immunofluorescence of monoclonal antibody to UBASH3B on HeLa cell. [antibody concentration 10 ug/ml] |
| | Image 3 | Formalin-fixed paraffin-embedded human colon
 | Immunoperoxidase of monoclonal antibody to UBASH3B on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
|
|
