| Product Number |
OAAL00040 |
| Product Page |
www.avivasysbio.com/cav3-antibody-oaal00040.html |
| Name |
CAV3 Antibody (OAAL00040) |
| Clone |
1B9 |
| Isotype |
IgG2b Kappa |
| NCBI Gene Id |
859 |
| Host |
Mouse |
| Clonality |
Monoclonal |
| Gene Full Name |
caveolin 3 |
| Alias Symbols |
caveolin-3;cavolin 3;LGMD1C;LQT9;M-caveolin;MPDT;RMD2;VIP21;VIP-21. |
| Peptide Sequence |
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP |
| Product Format |
Liquid |
| Description of Target |
This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq |
| Reconstitution and Storage |
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Datasheets/Manuals |
Printable datasheet for CAV3 Antibody (OAAL00040) |
| Immunogen |
CAV3 (NP_001225, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Formulation |
In 1x PBS, pH 7.4 |
| Protein Name |
caveolin-3 [Homo sapiens]|Homo sapiens caveolin 3 (CAV3), transcript variant 2, mRNA |
| Protein Accession # |
https://www.ncbi.nlm.nih.gov/protein/NP_001225 |
| Nucleotide Accession # |
https://www.ncbi.nlm.nih.gov/nuccore/NM_001234 |
| Gene Symbol |
CAV3 |
| Predicted Species Reactivity |
Human, Mouse |
| Application |
Enzyme-linked immunosorbent assay|Western blot |
| Image 1 | Recombinant GST tagged CAV3
 | Detection limit for recombinant GST tagged CAV3 is 0.3 ng/ml as a capture antibody. |
|
|
