| Product Number |
OAAL00024 |
| Product Page |
www.avivasysbio.com/baat-antibody-oaal00024.html |
| Name |
BAAT Antibody (OAAL00024) |
| Clone |
1E4 |
| Isotype |
IgG2a Kappa |
| NCBI Gene Id |
570 |
| Host |
Mouse |
| Clonality |
Monoclonal |
| Gene Full Name |
bile acid-CoA:amino acid N-acyltransferase |
| Alias Symbols |
BACAT;BACD1;BAT;bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase);bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase);bile acid-CoA thioesterase;bile acid-CoA:amino acid N-acyltransferase;choloyl-CoA hydrolase;HCHO;long-chain fatty-acyl-CoA hydrolase. |
| Peptide Sequence |
NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL |
| Product Format |
Liquid |
| Description of Target |
The protein encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
| Reconstitution and Storage |
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Datasheets/Manuals |
Printable datasheet for BAAT Antibody (OAAL00024) |
| Immunogen |
BAAT (NP_001692, 258 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Formulation |
In 1x PBS, pH 7.4 |
| Protein Name |
bile acid-CoA:amino acid N-acyltransferase [Homo sapiens]|Homo sapiens bile acid-CoA:amino acid N-acyltransferase (BAAT), transcript variant 1, mRNA |
| Protein Accession # |
https://www.ncbi.nlm.nih.gov/protein/NP_001692 |
| Nucleotide Accession # |
https://www.ncbi.nlm.nih.gov/nuccore/NM_001701 |
| Gene Symbol |
BAAT |
| Predicted Species Reactivity |
Human, Mouse |
| Application |
Enzyme-linked immunosorbent assay|Western blot |
| Image 1 | HL-60
 | BAAT monoclonal antibody (M03), clone 1E4. Western Blot analysis of BAAT expression in HL-60. |
|
|
