| Product Number |
OAAF08179 |
| Product Page |
www.avivasysbio.com/histone-h3-antibody-acetyl-lys18-oaaf08179.html |
| Name |
Histone H3 Antibody (Acetyl-Lys18) (OAAF08179) |
| Molecular Weight |
15 kDa |
| Isotype |
IgG |
| NCBI Gene Id |
126961|3020|3021|3023|333932|653604|8350|8351|8352|8353|8354|8355|8356|8357|8358|8968 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1mg/ml |
| Gene Full Name |
H3 clustered histone 1|H3 clustered histone 10|H3 clustered histone 11|H3 clustered histone 12|H3 clustered histone 13|H3 clustered histone 14|H3 clustered histone 15 |
| Alias Symbols |
H3;H3 histone family member 3A;H3 histone family member 3B;H3 histone family, member A;H3 histone family, member B;H3 histone family, member C;H3 histone family, member D;H3 histone family, member F;H3 histone family, member H;H3 histone family, member I;H3 histone family, member J;H3 histone family, member K;H3 histone family, member L;H3 histone family, member M;H3 histone, family 2;H3 histone, family 3A;H3 histone, family 3B (H3.3B);H3.1;H3.2;H3.3A;H3.3B;H3.f;H3/A;H3/b;H3/c;H3/d;H3/f;H3/h;H3/i;H3/j;H3/k;H3/l;H3/M;H3/n;H3/o;H3-3A;H3-3B;H3C1;H3C10;H3C11;H3C12;H3C13;H3C14;H3C15;H3C2;H3C3;H3C4;H3C6;H3C7;H3C8;H3-clustered histone 13;H3-clustered histone 14;H3-clustered histone 15;H3F1K;H3F2;H3F3;H3F3A;H3F3B;H3FA;H3FB;H3FC;H3FD;H3FF;H3FH;H3FI;H3FJ;H3FK;H3FL;H3FM;H3FN;HIST1H3A;HIST1H3B;HIST1H3C;HIST1H3D;HIST1H3E;HIST1H3F;HIST1H3G;HIST1H3H;HIST1H3I;HIST1H3J;HIST2H3A;HIST2H3C;HIST2H3D;histone 1, H3a;histone 1, H3b;histone 1, H3c;histone 1, H3d;histone 1, H3e;histone 1, H3f;histone 1, H3g;histone 1, H3h;histone 1, H3i;histone 1, H3j;histone 2, H3a;histone 2, H3c;histone 2, H3d;histone cluster 1 H3 family member a;histone cluster 1 H3 family member b;histone cluster 1 H3 family member c;histone cluster 1 H3 family member d;histone cluster 1 H3 family member e;histone cluster 1 H3 family member f;histone cluster 1 H3 family member g;histone cluster 1 H3 family member h;histone cluster 1 H3 family member i;histone cluster 1 H3 family member j;histone cluster 1, H3a;histone cluster 1, H3b;histone cluster 1, H3c;histone cluster 1, H3d;histone cluster 1, H3e;histone cluster 1, H3f;histone cluster 1, H3g;histone cluster 1, H3h;histone cluster 1, H3i;histone cluster 1, H3j;histone cluster 2 H3 family member a;histone cluster 2 H3 family member c;histone cluster 2 H3 family member d;histone cluster 2, H3a;histone cluster 2, H3c;histone cluster 2, H3d;histone H3.1;histone H3.2;histone H3.3;histone H3/a;histone H3/b;histone H3/c;histone H3/d;histone H3/f;histone H3/h;histone H3/i;histone H3/j;histone H3/k;histone H3/l;histone H3/m;histone H3/o. |
| Peptide Sequence |
Synthetic peptide located within the following region: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALR |
| Product Format |
Liquid. Phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Description of Target |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.|Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. |
| Reconstitution and Storage |
-20°C |
| Datasheets/Manuals |
Printable datasheet for Histone H3 Antibody (Acetyl-Lys18) (OAAF08179) |
| Specificity |
Histone H3 (Acetyl-Lys18) Antibody detects endogenous levels of total Histone H3 protein only when acetylated at Lys18. |
| Additional Information |
Modification Sites:
Human:K18
Mouse:K18
Rat:K18
Target Modification: Acetyl |
| Application Info |
WB: 1:500~1:1000
IHC: 1:50~1:100
IF: 1:100~1:500
ELISA: 1:5000 |
| Immunogen |
The antiserum was produced against synthesized peptide derived from human Histone H3 around the acetylated site of Lys18. |
| Uniprot ID |
P68431|P84243|Q71DI3 |
| Protein Name |
Histone H3.1|Histone H3.2|Histone H3.3 |
| Purification |
The antibody was purified from rabbit antiserum by affinity-chromatography using acetylated peptide. The antibody against non-acetylated peptide was removed by chromatography using corresponding non-acetylated peptide. |
| Gene Symbol |
H3-3A|H3-3B|H3C1|H3C10|H3C11|H3C12|H3C13|H3C14|H3C15|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8|H4F3 |
| Predicted Species Reactivity |
Human|Mouse|Rat |
| Application |
Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Image 1 | HeLa cells
 | Immunofluorescence analysis of HeLa cells, using Histone H3 (Acetyl-Lys18) Antibody. The picture on the right is blocked with the synthesized peptide. |
|
| Image 2 | HeLa cells
 | Western blot analysis of lysates from HeLa cells, treated with TSA 400nM 24h, using Histone H3 (Acetyl-Lys18) Antibody. The lane on the right is blocked with the synthesized peptide. |
|
| Image 3 | Paraffin-embedded human lung carcinoma
 | Immunohistochemistry analysis of paraffin-embedded human lung carcinoma tissue, using Histone H3 (Acetyl-Lys18) Antibody. The picture on the right is blocked with the synthesized peptide. |
|
