| Product Number |
OAAF07880 |
| Product Page |
www.avivasysbio.com/arhgdia-antibody-oaaf07880.html |
| Name |
ARHGDIA Antibody (OAAF07880) |
| Molecular Weight |
23 kDa |
| NCBI Gene Id |
396 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1mg/ml |
| Gene Full Name |
Rho GDP dissociation inhibitor alpha |
| Alias Symbols |
epididymis secretory sperm binding protein Li 47e;GDIA1;GDP-dissociation inhibitor, aplysia RAS-related 1;HEL-S-47e;NPHS8;Rho GDP dissociation inhibitor (GDI) alpha;rho GDP-dissociation inhibitor 1;RHOGDI;Rho-GDI alpha;RHOGDI-1. |
| Peptide Sequence |
Synthetic peptide located within the following region: DKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDH |
| Description of Target |
Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1. |
| Reconstitution and Storage |
-20°C |
| Datasheets/Manuals |
Printable datasheet for ARHGDIA Antibody (OAAF07880) |
| Specificity |
ARHGDIA Antibody detects endogenous levels of total ARHGDIA protein. |
| Application Info |
IHC: 1:50~1:100
ELISA: 1:5000 |
| Immunogen |
The antiserum was produced against synthesized peptide derived from human ARHGDIA. |
| Formulation |
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Uniprot ID |
P52565 |
| Protein Name |
Rho GDP-dissociation inhibitor 1 |
| Purification |
The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen. |
| Gene Symbol |
ARHGDIA |
| Predicted Species Reactivity |
Human|Mouse|Rat |
| Application |
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin |
| Image 1 | Paraffin-embedded human cervix carcinoma
 | Immunohistochemistry analysis of paraffin-embedded human cervix carcinoma tissue, using ARHGDIA Antibody. The picture on the right is blocked with the synthesized peptide. |
|
|
