HER4 Antibody (Phospho-Tyr1284) (OAAF07575)

• Product Number: OAAF07575
• Name: HER4 Antibody (Phospho-Tyr1284) (OAAF07575)
• Molecular Weight: 146 kDa
• NCBI Gene Id: 2066
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1mg/ml
• Gene Full Name: erb-b2 receptor tyrosine kinase 4
• Alias Symbols: ALS19;avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4;HER4;human epidermal growth factor receptor 4;p180erbB4;proto-oncogene-like protein c-ErbB-4;receptor tyrosine-protein kinase erbB-4;tyrosine kinase-type cell surface receptor HER4;v-erb-a erythroblastic leukemia viral oncogene homolog 4;v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4.
• Peptide Sequence: Synthetic peptide located within the following region: RSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPP
• Description of Target: Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins and EGF family members and regulates development of the heart, the central nervous system and the mammary gland, gene transcription, cell proliferation, differentiation, migration and apoptosis. Required for normal cardiac muscle differentiation during embryonic development, and for postnatal cardiomyocyte proliferation. Required for normal development of the embryonic central nervous system, especially for normal neural crest cell migration and normal axon guidance. Required for mammary gland differentiation, induction of milk proteins and lactation. Acts as cell-surface receptor for the neuregulins NRG1, NRG2, NRG3 and NRG4 and the EGF family members BTC, EREG and HBEGF. Ligand binding triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Ligand specificity and signaling is modulated by alternative splicing, proteolytic processing, and by the formation of heterodimers with other ERBB family members, thereby creating multiple combinations of intracellular phosphotyrosines that trigger ligand- and context-specific cellular responses. Mediates phosphorylation of SHC1 and activation of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Isoform JM-A CYT-1 and isoform JM-B CYT-1 phosphorylate PIK3R1, leading to the activation of phosphatidylinositol 3-kinase and AKT1 and protect cells against apoptosis. Isoform JM-A CYT-1 and isoform JM-B CYT-1 mediate reorganization of the actin cytoskeleton and promote cell migration in response to NRG1. Isoform JM-A CYT-2 and isoform JM-B CYT-2 lack the phosphotyrosine that mediates interaction with PIK3R1, and hence do not phosphorylate PIK3R1, do not protect cells against apoptosis, and do not promote reorganization of the actin cytoskeleton and cell migration. Proteolytic processing of isoform JM-A CYT-1 and isoform JM-A CYT-2 gives rise to the corresponding soluble intracellular domains (4ICD) that translocate to the nucleus, promote nuclear import of STAT5A, activation of STAT5A, mammary epithelium differentiation, cell proliferation and activation of gene expression. The ERBB4 soluble intracellular domains (4ICD) colocalize with STAT5A at the CSN2 promoter to regulate transcription of milk proteins during lactation. The ERBB4 soluble intracellular domains can also translocate to mitochondria and promote apoptosis.
• Reconstitution and Storage: -20°C
• Specificity: HER4 (Phospho-Tyr1284) Antibody detects endogenous levels of HER4 only when phosphorylated at Tyr1284.
• Additional Information: Modification Sites: Human:Y1284 Mouse:Y1268 Rat:Y1284
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:10000
• Immunogen: The antiserum was produced against synthesized peptide derived from human HER4 around the phosphorylation site of Tyr1284.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Uniprot ID: Q15303
• Protein Name: Receptor tyrosine-protein kinase erbB-4
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Gene Symbol: ERBB4
• Predicted Species Reactivity: Human|Mouse|Rat
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Image 1: HeLa cells
  
  Immunofluorescence analysis of HeLa cells treated with EGF 200nM 5', using HER4 (Phospho-Tyr1284) Antibody. The picture on the right is blocked with the phospho peptide.
• Image 2: Paraffin-embedded human breast carcinoma
  
  Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using HER4 (Phospho-Tyr1284) Antibody. The picture on the right is blocked with the phospho peptide.
• Image 3: HUVEC cells
  
  Western blot analysis of lysates from HUVEC cells treated with EGF 200ng/ml 30', using HER4 (Phospho-Tyr1284) Antibody. The lane on the right is blocked with the phospho peptide.