Product Number |
OAAF07556 |
Product Page |
www.avivasysbio.com/erk3-antibody-phospho-ser189-oaaf07556.html |
Name |
ERK3 Antibody (Phospho-Ser189) (OAAF07556) |
Molecular Weight |
82 kDa |
NCBI Gene Id |
5597 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1mg/ml |
Gene Full Name |
mitogen-activated protein kinase 6 |
Alias Symbols |
ERK3;ERK-3;extracellular signal-regulated kinase 3;extracellular signal-regulated kinase, p97;HsT17250;MAP kinase 6;MAP kinase isoform p97;MAPK 6;mitogen-activated protein kinase 6;p97MAPK;p97-MAPK;PRKM6;protein kinase, mitogen-activated 5;protein kinase, mitogen-activated 6. |
Peptide Sequence |
Synthetic peptide located within the following region: PANLFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEGLVTKWYRSPRLLL |
Description of Target |
Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity). |
Reconstitution and Storage |
-20°C |
Datasheets/Manuals |
Printable datasheet for ERK3 Antibody (Phospho-Ser189) (OAAF07556) |
Specificity |
ERK3 (Phospho-Ser189) Antibody detects endogenous levels of ERK3 only when phosphorylated at Ser189. |
Additional Information |
Modification Sites: Human:S189 Mouse:S189 Rat:S189 |
Application Info |
WB: 1:500~1:1000 IHC: 1:50~1:100 ELISA: 1:5000 |
Immunogen |
The antiserum was produced against synthesized peptide derived from human ERK3 around the phosphorylation site of Ser189. |
Formulation |
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Uniprot ID |
Q16659 |
Protein Name |
Mitogen-activated protein kinase 6 |
Purification |
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Gene Symbol |
MAPK6 |
Predicted Species Reactivity |
Human|Mouse|Rat |
Application |
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Image 1 | Mouse brain
| Western blot analysis of lysates from mouse brain, using ERK3 (Phospho-Ser189) Antibody. The lane on the right is blocked with the phospho peptide. |
|
Image 2 | Paraffin-embedded human breast carcinoma
| Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using ERK3 (Phospho-Ser189) Antibody. The picture on the right is blocked with the phospho peptide. |
|