ERK3 Antibody (Phospho-Ser189) (OAAF07556)

Data Sheet
 
Product Number OAAF07556
Product Page www.avivasysbio.com/erk3-antibody-phospho-ser189-oaaf07556.html
Name ERK3 Antibody (Phospho-Ser189) (OAAF07556)
Molecular Weight 82 kDa
NCBI Gene Id 5597
Host Rabbit
Clonality Polyclonal
Concentration 1mg/ml
Gene Full Name mitogen-activated protein kinase 6
Alias Symbols ERK3;ERK-3;extracellular signal-regulated kinase 3;extracellular signal-regulated kinase, p97;HsT17250;MAP kinase 6;MAP kinase isoform p97;MAPK 6;mitogen-activated protein kinase 6;p97MAPK;p97-MAPK;PRKM6;protein kinase, mitogen-activated 5;protein kinase, mitogen-activated 6.
Peptide Sequence Synthetic peptide located within the following region: PANLFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEGLVTKWYRSPRLLL
Description of Target Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity).
Reconstitution and Storage -20°C
Datasheets/Manuals Printable datasheet for ERK3 Antibody (Phospho-Ser189) (OAAF07556)
Specificity ERK3 (Phospho-Ser189) Antibody detects endogenous levels of ERK3 only when phosphorylated at Ser189.
Additional Information Modification Sites: Human:S189 Mouse:S189 Rat:S189
Application Info WB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:5000
Immunogen The antiserum was produced against synthesized peptide derived from human ERK3 around the phosphorylation site of Ser189.
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Uniprot ID Q16659
Protein Name Mitogen-activated protein kinase 6
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Gene Symbol MAPK6
Predicted Species Reactivity Human|Mouse|Rat
Application Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Image 1
Mouse brain
Western blot analysis of lysates from mouse brain, using ERK3 (Phospho-Ser189) Antibody. The lane on the right is blocked with the phospho peptide.
Image 2
Paraffin-embedded human breast carcinoma
Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using ERK3 (Phospho-Ser189) Antibody. The picture on the right is blocked with the phospho peptide.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com