Product Number |
OAAF07363 |
Product Page |
www.avivasysbio.com/ku80-antibody-phospho-thr714-oaaf07363.html |
Name |
Ku80 Antibody (Phospho-Thr714) (OAAF07363) |
Molecular Weight |
82 kDa |
NCBI Gene Id |
7520 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1mg/ml |
Gene Full Name |
X-ray repair cross complementing 5 |
Alias Symbols |
86 kDa subunit of Ku antigen;ATP-dependent DNA helicase 2 subunit 2;ATP-dependent DNA helicase II 80 kDa subunit;CTC box-binding factor 85 kDa subunit;CTC85;CTCBF;DNA repair protein XRCC5;KARP1;KARP-1;Ku autoantigen, 80kDa;KU80;Ku86;Ku86 autoantigen related protein 1;KUB2;lupus Ku autoantigen protein p86;NFIV;nuclear factor IV;thyroid-lupus autoantigen;TLAA;X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining);X-ray repair cross-complementing protein 5. |
Peptide Sequence |
Synthetic peptide located within the following region: ITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI |
Description of Target |
Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together (PubMed:12145306, PubMed:20383123, PubMed:7957065, PubMed:8621488). The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. In association with NAA15, the XRCC5/6 dimer binds to the osteocalcin promoter and activates osteocalcin expression (PubMed:20383123). The XRCC5/6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription (PubMed:8621488). Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway. |
Reconstitution and Storage |
-20°C |
Datasheets/Manuals |
Printable datasheet for Ku80 Antibody (Phospho-Thr714) (OAAF07363) |
Specificity |
Ku80 (Phospho-Thr714) Antibody detects endogenous levels of Ku80 only when phosphorylated at Thr714. |
Additional Information |
Modification Sites: Human:T714 |
Application Info |
WB: 1:500~1:1000 IHC: 1:50~1:100 IF: 1:100~1:500 ELISA: 1:1000 |
Immunogen |
The antiserum was produced against synthesized peptide derived from human Ku80 around the phosphorylation site of Thr714. |
Formulation |
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Uniprot ID |
P13010 |
Protein Name |
X-ray repair cross-complementing protein 5 |
Purification |
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Gene Symbol |
XRCC5 |
Predicted Species Reactivity |
Human|Monkey |
Application |
Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Image 1 | COS7 cells
| Western blot analysis of lysates from COS7 cells, using Ku80 (Phospho-Thr714) Antibody. The lane on the right is blocked with the phospho peptide. |
|
Image 2 | HeLa cells
| Immunofluorescence analysis of HeLa cells, using Ku80 (Phospho-Thr714) Antibody. The picture on the right is blocked with the phospho peptide. |
|
Image 3 | Paraffin-embedded human lung carcinoma
| Immunohistochemistry analysis of paraffin-embedded human lung carcinoma, using Ku80 (Phospho-Thr714) Antibody. The picture on the right is blocked with the phospho peptide. |
|