Ku80 Antibody (Phospho-Thr714) (OAAF07363)

Data Sheet
 
Product Number OAAF07363
Product Page www.avivasysbio.com/ku80-antibody-phospho-thr714-oaaf07363.html
Name Ku80 Antibody (Phospho-Thr714) (OAAF07363)
Molecular Weight 82 kDa
NCBI Gene Id 7520
Host Rabbit
Clonality Polyclonal
Concentration 1mg/ml
Gene Full Name X-ray repair cross complementing 5
Alias Symbols 86 kDa subunit of Ku antigen;ATP-dependent DNA helicase 2 subunit 2;ATP-dependent DNA helicase II 80 kDa subunit;CTC box-binding factor 85 kDa subunit;CTC85;CTCBF;DNA repair protein XRCC5;KARP1;KARP-1;Ku autoantigen, 80kDa;KU80;Ku86;Ku86 autoantigen related protein 1;KUB2;lupus Ku autoantigen protein p86;NFIV;nuclear factor IV;thyroid-lupus autoantigen;TLAA;X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining);X-ray repair cross-complementing protein 5.
Peptide Sequence Synthetic peptide located within the following region: ITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Description of Target Single-stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together (PubMed:12145306, PubMed:20383123, PubMed:7957065, PubMed:8621488). The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. In association with NAA15, the XRCC5/6 dimer binds to the osteocalcin promoter and activates osteocalcin expression (PubMed:20383123). The XRCC5/6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription (PubMed:8621488). Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Reconstitution and Storage -20°C
Datasheets/Manuals Printable datasheet for Ku80 Antibody (Phospho-Thr714) (OAAF07363)
Specificity Ku80 (Phospho-Thr714) Antibody detects endogenous levels of Ku80 only when phosphorylated at Thr714.
Additional Information Modification Sites: Human:T714
Application Info WB: 1:500~1:1000
IHC: 1:50~1:100
IF: 1:100~1:500
ELISA: 1:1000
Immunogen The antiserum was produced against synthesized peptide derived from human Ku80 around the phosphorylation site of Thr714.
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Uniprot ID P13010
Protein Name X-ray repair cross-complementing protein 5
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Gene Symbol XRCC5
Predicted Species Reactivity Human|Monkey
Application Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Image 1
COS7 cells
Western blot analysis of lysates from COS7 cells, using Ku80 (Phospho-Thr714) Antibody. The lane on the right is blocked with the phospho peptide.
Image 2
HeLa cells
Immunofluorescence analysis of HeLa cells, using Ku80 (Phospho-Thr714) Antibody. The picture on the right is blocked with the phospho peptide.
Image 3
Paraffin-embedded human lung carcinoma
Immunohistochemistry analysis of paraffin-embedded human lung carcinoma, using Ku80 (Phospho-Thr714) Antibody. The picture on the right is blocked with the phospho peptide.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com