| Product Number |
OAAF07327 |
| Product Page |
www.avivasysbio.com/c-ebp-beta-antibody-phospho-thr235-188-oaaf07327.html |
| Name |
C/EBP-beta Antibody (Phospho-Thr235/188) (OAAF07327) |
| Molecular Weight |
36 kda |
| NCBI Gene Id |
1051 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1 mg/ml |
| Gene Full Name |
CCAAT enhancer binding protein beta |
| Alias Symbols |
C/EBP-beta;CCAAT/enhancer binding protein (C/EBP), beta;CCAAT/enhancer-binding protein beta;IL6DBP;interleukin 6-dependent DNA-binding protein;Liver activator protein;Liver-enriched inhibitory protein;NF-IL6;nuclear factor NF-IL6;nuclear factor of interleukin 6;TCF5;transcription factor 5;transcription factor C/EBP beta. |
| Peptide Sequence |
Synthetic peptide located within the following region: AGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYA |
| Product Format |
Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide |
| Description of Target |
Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:1741402, PubMed:9374525, PubMed:12048245, PubMed:18647749). Plays also a significant role in adipogenesis, as well as in the gluconeogenic pathway, liver regeneration, and hematopoiesis. The consensus recognition site is 5'-T[TG]NNGNAA[TG]-3'. Its functional capacity is governed by protein interactions and post-translational protein modifications. During early embryogenesis, plays essential and redundant functions with CEBPA. Has a promitotic effect on many cell types such as hepatocytes and adipocytes but has an antiproliferative effect on T-cells by repressing MYC expression, facilitating differentiation along the T-helper 2 lineage. Binds to regulatory regions of several acute-phase and cytokines genes and plays a role in the regulation of acute-phase reaction and inflammation. Plays also a role in intracellular bacteria killing (By similarity). During adipogenesis, is rapidly expressed and, after activation by phosphorylation, induces CEBPA and PPARG, which turn on the series of adipocyte genes that give rise to the adipocyte phenotype. The delayed transactivation of the CEBPA and PPARG genes by CEBPB appears necessary to allow mitotic clonal expansion and thereby progression of terminal differentiation (PubMed:20829347). Essential for female reproduction because of a critical role in ovarian follicle development (By similarity). Restricts osteoclastogenesis: together with NFE2L1; represses expression of DSPP during odontoblast differentiation (By similarity). |
| Reconstitution and Storage |
Store at -20°C for 1 year. |
| Datasheets/Manuals |
Printable datasheet for C/EBP-beta Antibody (Phospho-Thr235/188) (OAAF07327) |
| Specificity |
C/EBP-beta (Phospho-Thr235/188) Antibody detects endogenous levels of C/EBP-beta only when phosphorylated at Thr235/188. |
| Additional Information |
Modification Sites: Human:T235 Mouse:T188 Rat:T189 |
| Application Info |
WB: 1/500 - 1/2000
IHC: 1/100 - 1/300
IF: 1/200 - 1/1000
ELISA: 1/10000 |
| Immunogen |
The antiserum was produced against synthesized peptide derived from human C/EBP-beta around the phosphorylation site of Thr235/188. AA range: 201-250 |
| Uniprot ID |
P17676 |
| Protein Name |
CCAAT/enhancer-binding protein beta |
| Purification |
The antibody was affinity purified from rabbit antiserum by affinity chromatography using epitope specific immunogen. |
| Gene Symbol |
CEBPB |
| Predicted Species Reactivity |
Human|Mouse|Rat |
| Application |
Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Image 1 | Paraffin-embedded human breast carcinoma
 | Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using C/EBP-beta (Phospho-Thr235/188) Antibody. The picture on the right is blocked with the phospho peptide. |
|
| Image 2 | HepG2 cells
 | Immunofluorescence analysis of HepG2 cells, using C/EBP-beta (Phospho-Thr235/188) Antibody. The picture on the right is blocked with the phospho peptide. |
|
| Image 3 | HepG2 cells
 | Western blot analysis of lysates from HepG2 cells treated with EGF 200ng/ml 30', using C/EBP-beta (Phospho-Thr235/188) Antibody. The lane on the right is blocked with the phospho peptide. |
|
