TRH Antibody - C-terminal region (AVARP13110_P050)

• Product Number: AVARP13110_P050
• Name: TRH Antibody - C-terminal region (AVARP13110_P050)
• Protein Size (# AA): 242 amino acids
• Molecular Weight: 26kDa
• NCBI Gene Id: 7200
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Thyrotropin-releasing hormone
• Alias Symbols: TRF, Pro-TRH
• Peptide Sequence: Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ellerhorst,J.A., (2004) Clin. Cancer Res. 10 (16), 5531-5536
• Description of Target: TRH functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.
• Protein Interactions: TRHR; CPE; ARRB2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Specificity: This antibody is directed towards the pro-hormone form of TRH, not the processed tripeptide.
• Blocking Peptide: For anti-TRH (AVARP13110_P050) antibody is Catalog # AAP30767 (Previous Catalog # AAPP01429)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRH
• Uniprot ID: P20396
• Protein Name: Prothyroliberin
• Protein Accession #: NP_009048
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007117
• Tested Species Reactivity: Human
• Gene Symbol: TRH
• Predicted Species Reactivity: Human, Cow, Guinea Pig, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 84%; Human: 100%; Zebrafish: 92%
• Image 1: Human 293T
  
  WB Suggested Anti-TRH Antibody Titration: 0.2-1 ug/ml
  Positive Control: Transfected 293T