GABRG3 Antibody - N-terminal region (AVARP13101_T100)

Data Sheet
 
Product Number AVARP13101_T100
Product Page www.avivasysbio.com/gabrg3-antibody-n-terminal-region-avarp13101-t100.html
Name GABRG3 Antibody - N-terminal region (AVARP13101_T100)
Protein Size (# AA) 467 amino acids
Molecular Weight 54kDa
Subunit gamma-3
NCBI Gene Id 2567
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, gamma 3
Peptide Sequence Synthetic peptide located within the following region: LHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hadingham, K.L., et al., (1995) Eur. J. Pharmacol. 291:301-309.
Description of Target GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel.
Protein Interactions GABARAP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GABRG3 (AVARP13101_T100) antibody
Blocking Peptide For anti-GABRG3 (AVARP13101_T100) antibody is Catalog # AAP30694 (Previous Catalog # AAPP01351)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GABRG3
Uniprot ID Q99928
Protein Name Gamma-aminobutyric acid receptor subunit gamma-3
Protein Accession # NP_150092
Purification Protein A purified
Nucleotide Accession # NM_033223
Gene Symbol GABRG3
Predicted Species Reactivity Human, Mouse
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 85%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com