| Product Number |
AVARP13101_T100 |
| Product Page |
www.avivasysbio.com/gabrg3-antibody-n-terminal-region-avarp13101-t100.html |
| Name |
GABRG3 Antibody - N-terminal region (AVARP13101_T100) |
| Protein Size (# AA) |
467 amino acids |
| Molecular Weight |
54kDa |
| Subunit |
gamma-3 |
| NCBI Gene Id |
2567 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, gamma 3 |
| Peptide Sequence |
Synthetic peptide located within the following region: LHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hadingham, K.L., et al., (1995) Eur. J. Pharmacol. 291:301-309. |
| Description of Target |
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel. |
| Protein Interactions |
GABARAP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GABRG3 (AVARP13101_T100) antibody |
| Blocking Peptide |
For anti-GABRG3 (AVARP13101_T100) antibody is Catalog # AAP30694 (Previous Catalog # AAPP01351) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRG3 |
| Uniprot ID |
Q99928 |
| Protein Name |
Gamma-aminobutyric acid receptor subunit gamma-3 |
| Protein Accession # |
NP_150092 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_033223 |
| Gene Symbol |
GABRG3 |
| Predicted Species Reactivity |
Human, Mouse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 85% |
| Image 1 | |
|
