RPH3A Antibody - N-terminal region (AVARP13088_P050)

Data Sheet
 
Product Number AVARP13088_P050
Product Page www.avivasysbio.com/rph3a-antibody-n-terminal-region-avarp13088-p050.html
Name RPH3A Antibody - N-terminal region (AVARP13088_P050)
Protein Size (# AA) 690 amino acids
Molecular Weight 76kDa
NCBI Gene Id 22895
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Rabphilin 3A homolog (mouse)
Alias Symbols KIAA0985
Peptide Sequence Synthetic peptide located within the following region: GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Katkoori,V.R., (er) Front. Biosci. 13, 1050-1061 (2008)
Description of Target RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
Protein Interactions NRXN1; RAB15; RAB27A; GCH1; CASK; RAB3B; RAB3A; RAB8A; YWHAH; ADD2; RAB3C; MLPH; RAB26; RAB3D; RAB27B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPH3A (AVARP13088_P050) antibody
Blocking Peptide For anti-RPH3A (AVARP13088_P050) antibody is Catalog # AAP30757 (Previous Catalog # AAPP01418)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RPH3A
Uniprot ID Q9Y2J0-2
Protein Name Rabphilin-3A
Protein Accession # NP_055769
Purification Affinity Purified
Nucleotide Accession # NM_014954
Tested Species Reactivity Human
Gene Symbol RPH3A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Small Intestine
WB Suggested Anti-RPH3A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com