HTR1F Antibody - N-terminal region (AVARP13073_T100)

• Product Number: AVARP13073_T100
• Name: HTR1F Antibody - N-terminal region (AVARP13073_T100)
• Protein Size (# AA): 366 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 3355
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled
• Alias Symbols: 5HT6, MR77, 5-HT1F, HTR1EL, 5-HT-1F
• Peptide Sequence: Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lovenberg,T.W., et al., (1993) Proc. Natl. Acad. Sci. U.S.A. 90 (6), 2184-2188
• Description of Target: The 5-HT1F receptor is present in both human vascular and neuronal tissue. This gene is localized at 3p12.
• Protein Interactions: CAV1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HTR1F (AVARP13073_T100) antibody is Catalog # AAP30714 (Previous Catalog # AAPP01371)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1F
• Uniprot ID: P30939
• Protein Name: 5-hydroxytryptamine receptor 1F
• Protein Accession #: NP_000857
• Purification: Protein A purified
• Nucleotide Accession #: NM_000866
• Tested Species Reactivity: Human
• Gene Symbol: HTR1F
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 100%
• Image 1: Human Liver
  
  WB Suggested Anti-HTR1F Antibody Titration: 2.5ug/ml
  Positive Control: Human Liver