HTR1F Antibody - N-terminal region (AVARP13073_T100)

Data Sheet
 
Product Number AVARP13073_T100
Product Page www.avivasysbio.com/htr1f-antibody-n-terminal-region-avarp13073-t100.html
Name HTR1F Antibody - N-terminal region (AVARP13073_T100)
Protein Size (# AA) 366 amino acids
Molecular Weight 42kDa
NCBI Gene Id 3355
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled
Alias Symbols 5HT6, MR77, 5-HT1F, HTR1EL, 5-HT-1F
Peptide Sequence Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lovenberg,T.W., et al., (1993) Proc. Natl. Acad. Sci. U.S.A. 90 (6), 2184-2188
Description of Target The 5-HT1F receptor is present in both human vascular and neuronal tissue. This gene is localized at 3p12.
Protein Interactions CAV1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HTR1F (AVARP13073_T100) antibody
Blocking Peptide For anti-HTR1F (AVARP13073_T100) antibody is Catalog # AAP30714 (Previous Catalog # AAPP01371)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1F
Uniprot ID P30939
Protein Name 5-hydroxytryptamine receptor 1F
Protein Accession # NP_000857
Purification Protein A purified
Nucleotide Accession # NM_000866
Tested Species Reactivity Human
Gene Symbol HTR1F
Predicted Species Reactivity Human, Mouse, Rat, Cow, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 100%
Image 1
Human Liver
WB Suggested Anti-HTR1F Antibody Titration: 2.5ug/ml
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com