GRIA2 Antibody - N-terminal region (AVARP13060_T100)

Data Sheet
 
Product Number AVARP13060_T100
Product Page www.avivasysbio.com/gria2-antibody-n-terminal-region-avarp13060-t100.html
Name GRIA2 Antibody - N-terminal region (AVARP13060_T100)
Protein Size (# AA) 883 amino acids
Molecular Weight 99kDa
NCBI Gene Id 2891
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Glutamate receptor, ionotropic, AMPA 2
Alias Symbols GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2
Peptide Sequence Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sun, W., et al., (1994) NeuroReport 5:441-444.
Description of Target Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of GLU are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.
Protein Interactions Pick1; GTF3C2; Grip1; RAB11A; MYO5A; GRIA1; REST; GRIP2; SDCBP; NSF; SQSTM1; GRIA3; SPTAN1; PRKCA; DRD2; SPTBN1; GRIK2; CACNG2; GRIK5; GRID2; DLG4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GRIA2 (AVARP13060_T100) antibody
Blocking Peptide For anti-GRIA2 (AVARP13060_T100) antibody is Catalog # AAP30702 (Previous Catalog # AAPP01359)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
Uniprot ID P42262
Protein Name Glutamate receptor 2
Protein Accession # NP_000817
Purification Protein A purified
Nucleotide Accession # NM_000826
Tested Species Reactivity Mouse
Gene Symbol GRIA2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Mouse Gut
Sample Type: Mouse Gut TissuePrimary
Dilution: 20ug/mL and 4ug/mLSecondary (Goat Anti-Rabbit Cy3)
Dilution: 1:1500
Image 2
Mouse Liver
Host: Mouse
Target Name: GRIA2
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com