| Product Number |
AVARP13058_T100 |
| Product Page |
www.avivasysbio.com/rab3d-antibody-c-terminal-region-avarp13058-t100.html |
| Name |
RAB3D Antibody - C-terminal region (AVARP13058_T100) |
| Protein Size (# AA) |
219 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
9545 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
RAB3D, member RAS oncogene family |
| Alias Symbols |
GOV, D2-2, RAB16, RAD3D |
| Peptide Sequence |
Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Knop,M., (2004) EMBO J. 23 (15), 2982-2992 |
| Description of Target |
As a protein transport, RAB3D is probably involved in regulated exocytosis. |
| Protein Interactions |
Ccdc64b; RNF32; CEP55; MAST1; AP1M2; CYP2C9; APP; ATG16L1; RAB3IP; RIMS2; RPH3AL; CHM; AKT2; AKT1; RIMS1; RPH3A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RAB3D (AVARP13058_T100) antibody |
| Blocking Peptide |
For anti-RAB3D (AVARP13058_T100) antibody is Catalog # AAP30737 (Previous Catalog # AAPP01394) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB3D |
| Uniprot ID |
O95716 |
| Protein Name |
Ras-related protein Rab-3D |
| Protein Accession # |
NP_004274 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004283 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RAB3D |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Human: 100%; Mouse: 80%; Rabbit: 86%; Rat: 80% |
| Image 1 | BCAM0379 protein from B cenocepacia
 | WB Suggested Anti-RAB3D Antibody
Positive Control: Lane 1: BCAM0379 protein from B cenocepacia
Primary Antibody Dilution : 1:5000
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:5000
Submitted by: Katie Nurse |
| | Image 2 | Human 293T
 | WB Suggested Anti-RAB3D Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T |
|
|
