HTR2C Antibody - N-terminal region (AVARP13045_T100)

• Product Number: AVARP13045_T100
• Name: HTR2C Antibody - N-terminal region (AVARP13045_T100)
• Protein Size (# AA): 458 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 3358
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled
• Alias Symbols: HTR1C, 5-HT1C, 5-HT2C, 5HTR2C, 5-HTR2C
• Peptide Sequence: Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Saltzman, A.G., et al., (1991) Biochem. Biophys. Res. Commun. 181:1469-1478.
• Description of Target: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with g proteins that activate a phosphatidylinositol . calcium second messenger system.
• Protein Interactions: SNTA1; CALM1; LIN7C; MPDZ; DLG4; APBA1; GNAQ; HTR2C; ARRB2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HTR2C (AVARP13045_T100) antibody is Catalog # AAP30717 (Previous Catalog # AAPP01374)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2C
• Uniprot ID: P28335
• Protein Name: 5-hydroxytryptamine receptor 2C
• Sample Type Confirmation:

  HTR2C is supported by BioGPS gene expression data to be expressed in Daudi

• Protein Accession #: NP_000859
• Purification: Protein A purified
• Nucleotide Accession #: NM_000868
• Tested Species Reactivity: Human
• Gene Symbol: HTR2C
• Predicted Species Reactivity: Human, Mouse, Rat, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 85%
• Image 1: Human Daudi, Raji
  
  WB Suggested Anti-HTR2C Antibody Titration: 5.0ug/ml
  Positive Control:
  A:Daudi cell lysate
  B:Raji cell lysate
• Image 2: Human Fetal Heart
  
  Host: Rabbit
  Target Name: HTR2C
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Liver
  
  Host: Rabbit
  Target Name: HTR2C
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Fetal Muscle
  
  Host: Rabbit
  Target Name: HTR2C
  Sample Type: Human Fetal Muscle
  Antibody Dilution: 1.0ug/ml
• Image 5: Human Fetal Heart
  
  Host: Rabbit
  Target Name: HTR2C
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 6: Human Fetal Lung
  
  Host: Rabbit
  Target Name: HTR2C
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 7: Human Fetal Liver
  
  Host: Rabbit
  Target Name: HTR2C
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml