Product Number |
AVARP13040_T100 |
Product Page |
www.avivasysbio.com/grik4-antibody-n-terminal-region-avarp13040-t100.html |
Name |
GRIK4 Antibody - N-terminal region (AVARP13040_T100) |
Protein Size (# AA) |
956 amino acids |
Molecular Weight |
107kDa |
NCBI Gene Id |
2900 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Glutamate receptor, ionotropic, kainate 4 |
Alias Symbols |
KA1, EAA1, GRIK, GluK4 |
Peptide Sequence |
Synthetic peptide located within the following region: RAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPAS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kamboj, R.K., et al., (1994) J. Neurochem. 62:1-9. |
Description of Target |
L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of GLU are mediated by a variety of receptors that are named according to their selective agonists. |
Protein Interactions |
RUFY1; RAB5A; GRIK2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GRIK4 (AVARP13040_T100) antibody |
Blocking Peptide |
For anti-GRIK4 (AVARP13040_T100) antibody is Catalog # AAP30707 (Previous Catalog # AAPP01364) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIK4 |
Uniprot ID |
Q16099 |
Protein Name |
Glutamate receptor, ionotropic kainate 4 |
Protein Accession # |
NP_055434 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_014619 |
Gene Symbol |
GRIK4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90% |
Image 1 | Human Lung, Human Fetal Heart
| Host: Rabbit Target: GRIK4 Positive control (+): Human Lung (LU) Negative control (-): Human Fetal Heart (HE) Antibody concentration: 3ug/ml |
|
|