GRIK4 Antibody - N-terminal region (AVARP13040_T100)

• Product Number: AVARP13040_T100
• Name: GRIK4 Antibody - N-terminal region (AVARP13040_T100)
• Protein Size (# AA): 956 amino acids
• Molecular Weight: 107kDa
• NCBI Gene Id: 2900
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Glutamate receptor, ionotropic, kainate 4
• Alias Symbols: KA1, EAA1, GRIK, GluK4
• Peptide Sequence: Synthetic peptide located within the following region: RAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPAS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kamboj, R.K., et al., (1994) J. Neurochem. 62:1-9.
• Description of Target: L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of GLU are mediated by a variety of receptors that are named according to their selective agonists.
• Protein Interactions: RUFY1; RAB5A; GRIK2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GRIK4 (AVARP13040_T100) antibody is Catalog # AAP30707 (Previous Catalog # AAPP01364)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GRIK4
• Uniprot ID: Q16099
• Protein Name: Glutamate receptor, ionotropic kainate 4
• Protein Accession #: NP_055434
• Purification: Protein A purified
• Nucleotide Accession #: NM_014619
• Gene Symbol: GRIK4
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
• Image 1: Human Lung, Human Fetal Heart
  
  Host: Rabbit
  Target: GRIK4
  Positive control (+): Human Lung (LU)
  Negative control (-): Human Fetal Heart (HE)
  Antibody concentration: 3ug/ml