GRIK4 Antibody - N-terminal region (AVARP13040_T100)

Data Sheet
 
Product Number AVARP13040_T100
Product Page www.avivasysbio.com/grik4-antibody-n-terminal-region-avarp13040-t100.html
Name GRIK4 Antibody - N-terminal region (AVARP13040_T100)
Protein Size (# AA) 956 amino acids
Molecular Weight 107kDa
NCBI Gene Id 2900
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Glutamate receptor, ionotropic, kainate 4
Alias Symbols KA1, EAA1, GRIK, GluK4
Peptide Sequence Synthetic peptide located within the following region: RAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPAS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kamboj, R.K., et al., (1994) J. Neurochem. 62:1-9.
Description of Target L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of GLU are mediated by a variety of receptors that are named according to their selective agonists.
Protein Interactions RUFY1; RAB5A; GRIK2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GRIK4 (AVARP13040_T100) antibody
Blocking Peptide For anti-GRIK4 (AVARP13040_T100) antibody is Catalog # AAP30707 (Previous Catalog # AAPP01364)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GRIK4
Uniprot ID Q16099
Protein Name Glutamate receptor, ionotropic kainate 4
Protein Accession # NP_055434
Purification Protein A purified
Nucleotide Accession # NM_014619
Gene Symbol GRIK4
Predicted Species Reactivity Human, Mouse, Rat, Dog, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
Image 1
Human Lung, Human Fetal Heart
Host: Rabbit
Target: GRIK4
Positive control (+): Human Lung (LU)
Negative control (-): Human Fetal Heart (HE)
Antibody concentration: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com