GRIA2 Antibody - N-terminal region (AVARP13038_T100)

Data Sheet
 
Product Number AVARP13038_T100
Product Page www.avivasysbio.com/gria2-antibody-n-terminal-region-avarp13038-t100.html
Name GRIA2 Antibody - N-terminal region (AVARP13038_T100)
Protein Size (# AA) 883 amino acids
Molecular Weight 99kDa
NCBI Gene Id 2891
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Glutamate receptor, ionotropic, AMPA 2
Alias Symbols GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2
Peptide Sequence Synthetic peptide located within the following region: STSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTIT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gryder,D.S., et al., (2005) J. Neurochem. 94 (6), 1728-1738
Description of Target GRIA2 is one of the glutamate receptors, which are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with mul
Protein Interactions Pick1; GTF3C2; Grip1; RAB11A; MYO5A; GRIA1; REST; GRIP2; SDCBP; NSF; SQSTM1; GRIA3; SPTAN1; PRKCA; DRD2; SPTBN1; GRIK2; CACNG2; GRIK5; GRID2; DLG4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GRIA2 (AVARP13038_T100) antibody
Blocking Peptide For anti-GRIA2 (AVARP13038_T100) antibody is Catalog # AAP30703 (Previous Catalog # AAPP01360)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
Uniprot ID P42262
Protein Name Glutamate receptor 2
Protein Accession # NP_000817
Purification Protein A purified
Nucleotide Accession # NM_000826
Tested Species Reactivity Human, Mouse
Gene Symbol GRIA2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human HepG2
WB Suggested Anti-GRIA2 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Image 2
mouse brain Slices
Primary Antibodies Brain slices were incubated overnight in a solution of PBST (0.2%) + 10% Normal GOAT serum + a monoclonal mouse anti-Parvalbumin antibody (1:2000)+ rabbit anti-GRIA2 (Aviva systems Biology, 1ug/mL)and gently shaken overnight at 4 C. Secondary Antibodies Samples were washed 6x in PBS (10 min each at RT) and exposed to the following secondary antibodies o/n at 4 C: PBST (0.3%) + 10% normal goat serum + anti-mouse Alexa 488 (1:1000) + Anti-rabbit Alexa 555 (1:1000) for two hours. Samples were washed 6x in PBST mounted. Images acquired with a confocal microscope at 63X.
Image 3
Mouse Gut
Application: Immunohistochemistry
Species+tissue/cell type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStop
How many ug'sof tissue/cell lysate run on the gel: 11 m Mouse Gut Tissue
Primary antibody dilution: 1:50
Secondary antibody: Goat anti-rabbit-cy3
Secondary antibody dilution: 1:1500
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com