| Product Number |
AVARP13032_T100 |
| Product Page |
www.avivasysbio.com/gabrd-antibody-n-terminal-region-avarp13032-t100.html |
| Name |
GABRD Antibody - N-terminal region (AVARP13032_T100) |
| Protein Size (# AA) |
452 amino acids |
| Molecular Weight |
51kDa |
| Subunit |
delta |
| NCBI Gene Id |
2563 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, delta |
| Alias Symbols |
EJM7, EIG10, GEFSP5 |
| Peptide Sequence |
Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Emberger,W., et al., (2000) Cytogenet. Cell Genet. 89 (3-4), 281-282 |
| Description of Target |
Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit. |
| Protein Interactions |
NOTCH2NL; UBQLN1; UBQLN4; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GABRD (AVARP13032_T100) antibody |
| Blocking Peptide |
For anti-GABRD (AVARP13032_T100) antibody is Catalog # AAP30692 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRD |
| Uniprot ID |
O14764 |
| Protein Name |
Gamma-aminobutyric acid receptor subunit delta |
| Protein Accession # |
NP_000806 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000815 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GABRD |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100% |
| Image 1 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: GABRD
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 2 | Human Fetal Kidney
 | Host: Rabbit
Target Name: GABRD
Sample Tissue: Human Fetal Kidney
Antibody Dilution: 1.0ug/ml |
|
