GABRD Antibody - N-terminal region (AVARP13032_P050)

Data Sheet
 
Product Number AVARP13032_P050
Product Page www.avivasysbio.com/gabrd-antibody-n-terminal-region-avarp13032-p050.html
Name GABRD Antibody - N-terminal region (AVARP13032_P050)
Protein Size (# AA) 452 amino acids
Molecular Weight 51kDa
Subunit delta
NCBI Gene Id 2563
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, delta
Alias Symbols EJM7, EIG10, GEFSP5
Peptide Sequence Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Emberger,W., et al., (2000) Cytogenet. Cell Genet. 89 (3-4), 281-282
Description of Target Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. The GABRD gene encodes the delta subunit.Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit.
Protein Interactions NOTCH2NL; UBQLN1; UBQLN4; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GABRD (AVARP13032_P050) antibody
Blocking Peptide For anti-GABRD (AVARP13032_P050) antibody is Catalog # AAP30692 (Previous Catalog # AAPP01349)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GABRD
Uniprot ID O14764
Protein Name Gamma-aminobutyric acid receptor subunit delta
Protein Accession # NP_000806
Purification Affinity Purified
Nucleotide Accession # NM_000815
Tested Species Reactivity Human, Rat
Gene Symbol GABRD
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Image 1
Human Fetal Kidney
Host: Rabbit
Target Name: GABRD
Sample Tissue: Human Fetal Kidney
Antibody Dilution: 1.0ug/ml
Image 2
Rat brain section
Sample Type:
Rat brain section
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit-biotin, streptavidin-diaminobenzidine
Secondary Antibody Dilution:
1:500
Gene Name:
GABRD
Submitted by:
Dr. Amiel Rosenkranz, Rosalind Franklin University
Image 3
Human Muscle
Human Muscle
Image 4
Human 786-0 Whole Cell
Host: Rabbit
Target Name: GABRD
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com