Product Number |
AVARP13027_T100 |
Product Page |
www.avivasysbio.com/gabra3-antibody-n-terminal-region-avarp13027-t100.html |
Name |
GABRA3 Antibody - N-terminal region (AVARP13027_T100) |
Protein Size (# AA) |
492 amino acids |
Molecular Weight |
55kDa |
Subunit |
alpha-3 |
NCBI Gene Id |
2556 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, alpha 3 |
Peptide Sequence |
Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hadingham, K.L., et al., (1993) Mol. Pharmacol. 43:970-975. |
Description of Target |
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel. |
Protein Interactions |
SDCBP2; UGT2B7; UBQLN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GABRA3 (AVARP13027_T100) antibody |
Blocking Peptide |
For anti-GABRA3 (AVARP13027_T100) antibody is Catalog # AAP30685 (Previous Catalog # AAPP01342) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRA3 |
Uniprot ID |
P34903 |
Protein Name |
Gamma-aminobutyric acid receptor subunit alpha-3 |
Protein Accession # |
NP_000799 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000808 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
GABRA3 |
Predicted Species Reactivity |
Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | mouse bulbus
| mouse bulbus |
|
|