GABRA3 Antibody - N-terminal region (AVARP13027_T100)

Data Sheet
 
Product Number AVARP13027_T100
Product Page www.avivasysbio.com/gabra3-antibody-n-terminal-region-avarp13027-t100.html
Name GABRA3 Antibody - N-terminal region (AVARP13027_T100)
Protein Size (# AA) 492 amino acids
Molecular Weight 55kDa
Subunit alpha-3
NCBI Gene Id 2556
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, alpha 3
Peptide Sequence Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hadingham, K.L., et al., (1993) Mol. Pharmacol. 43:970-975.
Description of Target GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel.
Protein Interactions SDCBP2; UGT2B7; UBQLN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GABRA3 (AVARP13027_T100) antibody
Blocking Peptide For anti-GABRA3 (AVARP13027_T100) antibody is Catalog # AAP30685 (Previous Catalog # AAPP01342)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GABRA3
Uniprot ID P34903
Protein Name Gamma-aminobutyric acid receptor subunit alpha-3
Protein Accession # NP_000799
Purification Protein A purified
Nucleotide Accession # NM_000808
Tested Species Reactivity Mouse
Gene Symbol GABRA3
Predicted Species Reactivity Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
mouse bulbus
mouse bulbus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com