CHRNG Antibody - N-terminal region (AVARP13024_T100)

Data Sheet
 
Product Number AVARP13024_T100
Product Page www.avivasysbio.com/chrng-antibody-n-terminal-region-avarp13024-t100.html
Name CHRNG Antibody - N-terminal region (AVARP13024_T100)
Protein Size (# AA) 517 amino acids
Molecular Weight 57kDa
NCBI Gene Id 1146
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name cholinergic receptor nicotinic gamma subunit
Alias Symbols ACHRG
Peptide Sequence Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Arredondo,J., et al., (2005) Am. J. Pathol. 166 (2), 597-613
Description of Target The mammalian muscle-type acetylcholine receptor is a transmembrane pentameric glycoprotein with two alpha subunits, one beta, one delta, and one epsilon (in adult skeletal muscle) or gamma (in fetal and denervated muscle) subunit. This gene, which encodes the gamma subunit, is expressed prior to the thirty-third week of gestation in humans. The gamma subunit of the acetylcholine receptor plays a role in neuromuscular organogenesis and ligand binding and disruption of gamma subunit expression prevents the correct localization of the receptor in cell membranes. Mutations in this gene cause Escobar syndrome and a lethal form of multiple pterygium syndrome. Muscle-type acetylcholine receptor is the major antigen in the autoimmune disease myasthenia gravis.[
Protein Interactions Ubqln1; CHRNB4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CHRNG (AVARP13024_T100) antibody
Blocking Peptide For anti-CHRNG (AVARP13024_T100) antibody is Catalog # AAP30670
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNG
Uniprot ID Q86U77
Protein Name Acetylcholine receptor subunit gamma
Protein Accession # NP_000734
Purification Protein A purified
Nucleotide Accession # NM_000743
Tested Species Reactivity Human
Gene Symbol CHRNG
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85%
Image 1
Human MCF-7
WB Suggested Anti-CHRNG Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com