CHRNG Antibody - N-terminal region (AVARP13024_P050)

• Product Number: AVARP13024_P050
• Name: CHRNG Antibody - N-terminal region (AVARP13024_P050)
• Protein Size (# AA): 517 amino acids
• Molecular Weight: 58 kDa
• Subunit: gamma
• NCBI Gene Id: 1146
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cholinergic receptor, nicotinic, gamma (muscle)
• Alias Symbols: ACHRG
• Peptide Sequence: Synthetic peptide located within the following region: NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Morgan,N.V., (2006) Am. J. Hum. Genet. 79 (2), 390-395
• Description of Target: For background information on the acetylcholine receptor (AChR), see CHRNA1. Two forms of AChR are found in mammalian skeletal muscle cells. The mature form is predominant in innervated adult muscle and the embryonic form is present in fetal and denervated muscle. Embryonic and mature AChR differ by the replacement of the gamma subunit in the pentameric glycoprotein complex by its isoform, the epsilon subunit, which is specific to the mature AChR subtype. This switch is mediated by ARIA (acetylcholine receptor-inducing activity.For background information on the acetylcholine receptor (AChR), see CHRNA1 (MIM 100690). Two forms of AChR are found in mammalian skeletal muscle cells. The mature form is predominant in innervated adult muscle and the embryonic form is present in fetal and denervated muscle. Embryonic and mature AChR differ by the replacement of the gamma subunit in the pentameric glycoprotein complex by its isoform, the epsilon subunit (MIM 100725), which is specific to the mature AChR subtype. This switch is mediated by ARIA (acetylcholine receptor-inducing activity; MIM 142445).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2187 AK125362.1 1-2187
• Protein Interactions: NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-9; KRTAP10-7; KRT31; CHRNA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-CHRNG (AVARP13024_P050) antibody is Catalog # AAP30681 (Previous Catalog # AAPP01338)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNG
• Uniprot ID: P07510
• Protein Name: Acetylcholine receptor subunit gamma
• Protein Accession #: NP_005190
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005199
• Tested Species Reactivity: Human
• Gene Symbol: CHRNG
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85%
• Image 1: Human MCF-7
  
  WB Suggested Anti-CHRNG Antibody
  Titration: 1 ug/ml
  Positive Control: MCF7 Whole Cell
• Image 2:
  
  25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein is processed to 55 kDa and may be glycosylated.