CHRNE Antibody - N-terminal region (AVARP13023_T100)

• Product Number: AVARP13023_T100
• Name: CHRNE Antibody - N-terminal region (AVARP13023_T100)
• Protein Size (# AA): 493 amino acids
• Molecular Weight: 55kDa
• Subunit: epsilon
• NCBI Gene Id: 1145
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Cholinergic receptor, nicotinic, epsilon (muscle)
• Alias Symbols: ACHRE, CMS1D, CMS1E, CMS2A, CMS4A, CMS4B, CMS4C, FCCMS, SCCMS
• Peptide Sequence: Synthetic peptide located within the following region: GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLIS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Beeson D.M.W, et al., (1993) Eur. J. Biochem. 215:229-238.
• Description of Target: After binding acetylcholine, the ACHR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
• Protein Interactions: CHRNA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CHRNE (AVARP13023_T100) antibody is Catalog # AAP30680 (Previous Catalog # AAPP01337)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNE
• Uniprot ID: Q04844
• Protein Name: Acetylcholine receptor subunit epsilon
• Protein Accession #: NP_000071
• Purification: Protein A purified
• Nucleotide Accession #: NM_000080
• Tested Species Reactivity: Human
• Gene Symbol: CHRNE
• Predicted Species Reactivity: Mouse, Rat, Guinea Pig, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 84%; Mouse: 91%; Pig: 80%; Rat: 91%
• Image 1: Human HepG2
  
  WB Suggested Anti-CHRNE Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysate