| Product Number |
AVARP13020_T100 |
| Product Page |
www.avivasysbio.com/chrnb2-antibody-n-terminal-region-avarp13020-t100.html |
| Name |
CHRNB2 Antibody - N-terminal region (AVARP13020_T100) |
| Protein Size (# AA) |
502 amino acids |
| Molecular Weight |
57kDa |
| Subunit |
beta-2 |
| NCBI Gene Id |
1141 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Cholinergic receptor, nicotinic, beta 2 (neuronal) |
| Alias Symbols |
EFNL3, nAChRB2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hales,T.G., et al., (2006) J. Biol. Chem. 281 (12), 8062-8071 |
| Description of Target |
The nicotinic acetylcholine receptors are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. Mutations in neuronal nicotinic acetylcholine receptor beta 2 subunit have been associated with autosomal dominant nocturnal frontal lobe epilepsies. |
| Protein Interactions |
CRELD2; CHRNA4; CHRNA2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHRNB2 (AVARP13020_T100) antibody |
| Blocking Peptide |
For anti-CHRNB2 (AVARP13020_T100) antibody is Catalog # AAP30677 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNB2 |
| Uniprot ID |
P17787 |
| Protein Name |
Neuronal acetylcholine receptor subunit beta-2 |
| Protein Accession # |
NP_000739 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000748 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
CHRNB2 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 83% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CHRNB2 Antibody
Titration: 1.25 ug/ml
Positive Control: HepG2 Whole Cell |
|
| Image 2 | Mouse Testis
 | Host: Mouse
Target Name: CHRNB2
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml |
|
| Image 3 | Human HT1080 Whole Cell
 | Host: Rabbit
Target Name: CHRNB2
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 3ug/ml |
|
