CHRNA9 Antibody - N-terminal region : Biotin (AVARP13019_P050-Biotin)

• Product Number: AVARP13019_P050-Biotin
• Name: CHRNA9 Antibody - N-terminal region : Biotin (AVARP13019_P050-Biotin)
• Protein Size (# AA): 479 amino acids
• Molecular Weight: 55kDa
• Subunit: alpha-9
• Conjugation: Biotin
• NCBI Gene Id: 55584
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cholinergic receptor, nicotinic, alpha 9 (neuronal)
• Alias Symbols: NACHRA9, HSA243342
• Peptide Sequence: Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Peng,H., et al., (2004) Life Sci. 76 (3), 263-280
• Description of Target: CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 is a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells.
• Protein Interactions: UBC; Rapsn;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-CHRNA9 (AVARP13019_P050-Biotin) antibody is Catalog # AAP30675 (Previous Catalog # AAPP01332)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA9
• Uniprot ID: Q9UGM1
• Protein Name: Neuronal acetylcholine receptor subunit alpha-9
• Publications:

  Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, -alpha9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). WB, IHC, Bovine, Dog, Guinea pig, Horse, Mouse, Rabbit, Zebrafish 24668500

• Protein Accession #: NP_060051
• Nucleotide Accession #: NM_017581
• Gene Symbol: CHRNA9
• Predicted Species Reactivity: Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 93%; Rabbit: 100%; Zebrafish: 80%
• Image 1: