| Product Number |
AVARP13014_P050 |
| Product Page |
www.avivasysbio.com/chrna3-antibody-n-terminal-region-avarp13014-p050.html |
| Name |
CHRNA3 Antibody - N-terminal region (AVARP13014_P050) |
| Protein Size (# AA) |
505 amino acids |
| Molecular Weight |
57kDa |
| Subunit |
alpha-3 |
| NCBI Gene Id |
1136 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cholinergic receptor, nicotinic, alpha 3 (neuronal) |
| Alias Symbols |
LNCR2, PAOD2, BAIPRCK, NACHRA3 |
| Peptide Sequence |
Synthetic peptide located within the following region: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Boorman,J.P., et al., (2003) J. Biol. Chem. 278 (45), 44033-44040 |
| Description of Target |
The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma. |
| Protein Interactions |
Ubqln1; CHRNB4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHRNA3 (AVARP13014_P050) antibody |
| Blocking Peptide |
For anti-CHRNA3 (AVARP13014_P050) antibody is Catalog # AAP30670 (Previous Catalog # AAPP01327) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA3 |
| Uniprot ID |
P32297 |
| Protein Name |
Neuronal acetylcholine receptor subunit alpha-3 |
| Protein Accession # |
NP_000734 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000743 |
| Tested Species Reactivity |
Human, Rat |
| Gene Symbol |
CHRNA3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85% |
| Image 1 | Human Thymus
 | WB Suggested Anti-CHRNA3 Antibody Titration: 0.1ug/ml
Positive Control: Human Thymus |
|
| Image 2 | Rat Skeletal Muscle
 | Host: Rat
Target Name: CHRNA3
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml |
|
| Image 3 | Rat Skeletal Muscle
 | Host: Rabbit
Target Name: CHRNA3
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml |
|
