CHRNA3 Antibody - N-terminal region (AVARP13014_P050)

Data Sheet
 
Product Number AVARP13014_P050
Product Page www.avivasysbio.com/chrna3-antibody-n-terminal-region-avarp13014-p050.html
Name CHRNA3 Antibody - N-terminal region (AVARP13014_P050)
Protein Size (# AA) 505 amino acids
Molecular Weight 57kDa
Subunit alpha-3
NCBI Gene Id 1136
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cholinergic receptor, nicotinic, alpha 3 (neuronal)
Alias Symbols LNCR2, PAOD2, BAIPRCK, NACHRA3
Peptide Sequence Synthetic peptide located within the following region: LPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Boorman,J.P., et al., (2003) J. Biol. Chem. 278 (45), 44033-44040
Description of Target The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.
Protein Interactions Ubqln1; CHRNB4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CHRNA3 (AVARP13014_P050) antibody
Blocking Peptide For anti-CHRNA3 (AVARP13014_P050) antibody is Catalog # AAP30670 (Previous Catalog # AAPP01327)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA3
Uniprot ID P32297
Protein Name Neuronal acetylcholine receptor subunit alpha-3
Protein Accession # NP_000734
Purification Affinity Purified
Nucleotide Accession # NM_000743
Tested Species Reactivity Human, Rat
Gene Symbol CHRNA3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85%
Image 1
Human Thymus
WB Suggested Anti-CHRNA3 Antibody Titration: 0.1ug/ml
Positive Control: Human Thymus
Image 2
Rat Skeletal Muscle
Host: Rat
Target Name: CHRNA3
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 3
Rat Skeletal Muscle
Host: Rabbit
Target Name: CHRNA3
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com