CCR8 Antibody - middle region (AVARP09059_T100)

Data Sheet
 
Product Number AVARP09059_T100
Product Page www.avivasysbio.com/ccr8-antibody-middle-region-avarp09059-t100.html
Name CCR8 Antibody - middle region (AVARP09059_T100)
Protein Size (# AA) 355 amino acids
Molecular Weight 41kDa
NCBI Gene Id 1237
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Chemokine (C-C motif) receptor 8
Alias Symbols CY6, TER1, CCR-8, CKRL1, CDw198, CMKBR8, GPRCY6, CMKBRL2, CC-CKR-8
Peptide Sequence Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Haque,N.S., et al., (2004) Blood 103 (4), 1296-1304
Description of Target CCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region.
Protein Interactions TPST2; TPST1; CCR8; CCL17; CCL16; CCL4; CCL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCR8 (AVARP09059_T100) antibody
Blocking Peptide For anti-CCR8 (AVARP09059_T100) antibody is Catalog # AAP30774 (Previous Catalog # AAPP01437)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCR8
Uniprot ID P51685
Protein Name C-C chemokine receptor type 8
Sample Type Confirmation

CCR8 is supported by BioGPS gene expression data to be expressed in K562

Protein Accession # NP_005192
Purification Protein A purified
Nucleotide Accession # NM_005201
Tested Species Reactivity Human
Gene Symbol CCR8
Predicted Species Reactivity Human, Cow, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Human: 100%; Rabbit: 81%
Image 1
Human K562
WB Suggested Anti-CCR8 Antibody Titration: 2.5ug/ml
Positive Control: K562 cell lysateCCR8 is supported by BioGPS gene expression data to be expressed in K562
Image 2
Human 786-0 Whole Cell
Host: Rabbit
Target Name: CCR8
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com