Product Number |
AVARP09059_T100 |
Product Page |
https://www.avivasysbio.com/ccr8-antibody-middle-region-avarp09059-t100.html |
Name |
CCR8 Antibody - middle region (AVARP09059_T100) |
Protein Size (# AA) |
355 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
1237 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chemokine (C-C motif) receptor 8 |
Alias Symbols |
CY6, TER1, CCR-8, CKRL1, CDw198, CMKBR8, GPRCY6, CMKBRL2, CC-CKR-8 |
Peptide Sequence |
Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Haque,N.S., et al., (2004) Blood 103 (4), 1296-1304 |
Description of Target |
CCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region. |
Protein Interactions |
TPST2; TPST1; CCR8; CCL17; CCL16; CCL4; CCL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CCR8 (AVARP09059_T100) antibody |
Blocking Peptide |
For anti-CCR8 (AVARP09059_T100) antibody is Catalog # AAP30774 (Previous Catalog # AAPP01437) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCR8 |
Uniprot ID |
P51685 |
Protein Name |
C-C chemokine receptor type 8 |
Sample Type Confirmation |
CCR8 is supported by BioGPS gene expression data to be expressed in K562 |
Protein Accession # |
NP_005192 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005201 |
Tested Species Reactivity |
Human |
Gene Symbol |
CCR8 |
Predicted Species Reactivity |
Human, Cow, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Human: 100%; Rabbit: 81% |
Image 1 | Human K562
 | WB Suggested Anti-CCR8 Antibody Titration: 2.5ug/ml Positive Control: K562 cell lysateCCR8 is supported by BioGPS gene expression data to be expressed in K562 |
|
Image 2 | Human 786-0 Whole Cell
 | Host: Rabbit Target Name: CCR8 Sample Tissue: Human 786-0 Whole Cell Antibody Dilution: 1ug/ml |
|