KIF20A Antibody - middle region (AVARP09058_P050)

Data Sheet
 
Product Number AVARP09058_P050
Product Page www.avivasysbio.com/kif20a-antibody-middle-region-avarp09058-p050.html
Name KIF20A Antibody - middle region (AVARP09058_P050)
Protein Size (# AA) 890 amino acids
Molecular Weight 100kDa
NCBI Gene Id 10112
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Kinesin family member 20A
Alias Symbols MKLP2, RAB6KIFL
Peptide Sequence Synthetic peptide located within the following region: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Description of Target KIF20A interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B.It may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility.
Protein Interactions FAM214B; UBC; EED; RNF2; ZRANB2; UBD; Mad2l1; Kif20a; RAB6B; RAB6A; AURKB; CDC14A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KIF20A (AVARP09058_P050) antibody
Additional Information IHC Information: Spleen, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Spleen, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Blocking Peptide For anti-KIF20A (AVARP09058_P050) antibody is Catalog # AAP30602 (Previous Catalog # AAPP01255)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KIF20A
Uniprot ID O95235
Protein Name Kinesin-like protein KIF20A
Sample Type Confirmation

KIF20A is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_005724
Purification Affinity Purified
Nucleotide Accession # NM_005733
Tested Species Reactivity Human
Gene Symbol KIF20A
Predicted Species Reactivity Human, Rat, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 86%
Image 1
Human 721_B
KIF20A antibody - middle region (AVARP09058_P050) validated by WB using 721_B Cell Lysate at 1ug/ml.KIF20A is supported by BioGPS gene expression data to be expressed in 721_B
Image 2
Human Uterus
Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue
Image 3
Human Uterus
Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue
Image 4
Human Thyroid
Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue
Image 5
Human Thyroid
Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF20A antibody (AVARP09058_P050)
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com