| Product Number |
AVARP09058_P050 |
| Product Page |
www.avivasysbio.com/kif20a-antibody-middle-region-avarp09058-p050.html |
| Name |
KIF20A Antibody - middle region (AVARP09058_P050) |
| Protein Size (# AA) |
890 amino acids |
| Molecular Weight |
100kDa |
| NCBI Gene Id |
10112 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Kinesin family member 20A |
| Alias Symbols |
MKLP2, RAB6KIFL |
| Peptide Sequence |
Synthetic peptide located within the following region: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Olsen,J.V., (2006) Cell 127 (3), 635-648 |
| Description of Target |
KIF20A interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B.It may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility. |
| Protein Interactions |
FAM214B; UBC; EED; RNF2; ZRANB2; UBD; Mad2l1; Kif20a; RAB6B; RAB6A; AURKB; CDC14A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KIF20A (AVARP09058_P050) antibody |
| Additional Information |
IHC Information: Spleen, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Spleen, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Blocking Peptide |
For anti-KIF20A (AVARP09058_P050) antibody is Catalog # AAP30602 (Previous Catalog # AAPP01255) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KIF20A |
| Uniprot ID |
O95235 |
| Protein Name |
Kinesin-like protein KIF20A |
| Sample Type Confirmation |
KIF20A is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_005724 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005733 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KIF20A |
| Predicted Species Reactivity |
Human, Rat, Dog, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 86% |
| Image 1 | Human 721_B
 | KIF20A antibody - middle region (AVARP09058_P050) validated by WB using 721_B Cell Lysate at 1ug/ml.KIF20A is supported by BioGPS gene expression data to be expressed in 721_B |
|
| Image 2 | Human Uterus
 | Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue |
|
| Image 3 | Human Uterus
 | Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue |
|
| Image 4 | Human Thyroid
 | Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue |
|
| Image 5 | Human Thyroid
 | Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF20A antibody (AVARP09058_P050) |
|
