| Product Number |
AVARP09055_T100 |
| Product Page |
www.avivasysbio.com/appd-antibody-c-terminal-region-avarp09055-t100.html |
| Name |
APPD Antibody - C-terminal region (AVARP09055_T100) |
| Protein Size (# AA) |
279 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
79156 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Pleckstrin homology domain containing, family F (with FYVE domain) member 1 |
| Alias Symbols |
APPD, LAPF, PHAFIN1, ZFYVE15 |
| Peptide Sequence |
Synthetic peptide located within the following region: QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg, R.L., et al (2002) Proc. Natl. Acad. Sci. U.S.A. 99:16899-16903. |
| Description of Target |
APPD (Apoptosis-inducing protein D; phafin 1) is predicted through gene annotation and contains pleckstrin homology domain. It may binds to two Zn++ ions through its FYVE zinc finger domain. Biological function of this protein has not been clearly mapped yet. |
| Protein Interactions |
L3MBTL3; UBC; KIAA1279; TNNT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PLEKHF1 (AVARP09055_T100) antibody |
| Blocking Peptide |
For anti-PLEKHF1 (AVARP09055_T100) antibody is Catalog # AAP30553 (Previous Catalog # AAPP01205) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human APPD |
| Uniprot ID |
Q96K11 |
| Protein Name |
Pleckstrin homology domain-containing family F member 1 |
| Protein Accession # |
NP_077286 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_024310 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PLEKHF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Yeast: 100% |
| Image 1 | Human Jurkat Whole cell
 | Host: Rabbit
Target Name: APPD
Sample Tissue: Human Jurkat Whole cell
Antibody Dilution: 1ug/ml |
|
