Product Number |
AVARP09047_P050 |
Product Page |
www.avivasysbio.com/bcl2a1-antibody-c-terminal-region-avarp09047-p050.html |
Name |
BCL2A1 Antibody - C-terminal region (AVARP09047_P050) |
Protein Size (# AA) |
175 amino acids |
Molecular Weight |
20kDa |
NCBI Gene Id |
597 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
BCL2-related protein A1 |
Alias Symbols |
GRS, ACC1, ACC2, BFL1, ACC-1, ACC-2, HBPA1, BCL2L5 |
Peptide Sequence |
Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kunter,U., et al., (2005) Kidney Int. 68 (4), 1520-1532 |
Description of Target |
BCL2A1s a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and has been shown to be up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. |
Protein Interactions |
FAM9B; NR4A1; BIK; BAK1; APP; HAT1; BBC3; PMAIP1; BOK; BCL2L11; HRK; BAD; BID; BAX; GRB2; BMF; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BCL2A1 (AVARP09047_P050) antibody |
Blocking Peptide |
For anti-BCL2A1 (AVARP09047_P050) antibody is Catalog # AAP30560 (Previous Catalog # AAPP01212) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human BCL2A1 |
Uniprot ID |
Q16548 |
Protein Name |
Bcl-2-related protein A1 |
Protein Accession # |
NP_004040 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004049 |
Tested Species Reactivity |
Human |
Gene Symbol |
BCL2A1 |
Predicted Species Reactivity |
Rat, Dog, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 90%; Pig: 85%; Rat: 78% |
Image 1 | Human Jurkat
| WB Suggested Anti-BCL2A1 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|