| Product Number |
AVARP09034_T100 |
| Product Page |
www.avivasysbio.com/rnasel-antibody-c-terminal-region-avarp09034-t100.html |
| Name |
RNASEL Antibody - C-terminal region (AVARP09034_T100) |
| Protein Size (# AA) |
741 amino acids |
| Molecular Weight |
84kDa |
| NCBI Gene Id |
6041 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) |
| Alias Symbols |
RNS4, PRCA1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Nakazato, H., et al., (2003) Br. J. Cancer 89 (4), 691-696. |
| Description of Target |
This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele. |
| Protein Interactions |
TCF12; UBC; ABCE1; AR; GSPT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RNASEL (AVARP09034_T100) antibody |
| Blocking Peptide |
For anti-RNASEL (AVARP09034_T100) antibody is Catalog # AAP30604 (Previous Catalog # AAPP01257) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEL |
| Uniprot ID |
Q05823 |
| Protein Name |
2-5A-dependent ribonuclease |
| Protein Accession # |
NP_066956 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021133 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RNASEL |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 78%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 92% |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: RNASEL
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml |
|
|
