CAV2 Antibody - N-terminal region (AVARP09020_P050)

Data Sheet
 
Product Number AVARP09020_P050
Product Page www.avivasysbio.com/cav2-antibody-n-terminal-region-avarp09020-p050.html
Name CAV2 Antibody - N-terminal region (AVARP09020_P050)
Protein Size (# AA) 162 amino acids
Molecular Weight 18kDa
NCBI Gene Id 858
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Caveolin 2
Alias Symbols CAV
Peptide Sequence Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sowa,G., (2008) Biochemistry 47 (1), 101-111
Description of Target CAV2 is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.
Protein Interactions EGFR; PTGS1; CSNK2A1; CAV1; MALL; KCNMA1; UBC; DNAJA1; GOLGB1; NCK1; SRC; RASA1; FLOT2; DRD1; PLD2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CAV2 (AVARP09020_P050) antibody
Blocking Peptide For anti-CAV2 (AVARP09020_P050) antibody is Catalog # AAP30145 (Previous Catalog # AAPP00302)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CAV2
Uniprot ID P51636
Protein Name Caveolin-2
Publications

Chi Sabins, N. et al. DLK1: a novel target for immunotherapeutic remodeling of the tumor blood vasculature. Mol. Ther. 21, 1958-68 (2013). 23896726

Protein Accession # NP_001224
Purification Affinity Purified
Nucleotide Accession # NM_001233
Tested Species Reactivity Human
Gene Symbol CAV2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Image 1
Human placental
Sample Type:
Human placental tissue
Primary Antibody Dilution:
1:50
Secondary Antibody:
Goat anti rabbit-HRP
Secondary Antibody Dilution:
1:10,000
Color/Signal Descriptions:
Brown: CAV2 Purple: Haemotoxylin
Gene Name:
CAV2
Submitted by:
Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham
Image 2
Human placenta
Lanes:
Lane1: 50 ug human placental tissue lysate
Lane2: 40 ug human placental tissue lysate
Lane3: 30 ug human placental tissue lysate
Lane4: 20 ug human placental tissue lysate
Lane5: 20 ug human myometrial tissue lysate
Primary Antibody Dilution:
1:500
Secondary Antibody:
Goat anti-rabbit HRP
Secondary Antibody Dilution:
1:10000
Gene Name:
Caveolin 2
Submitted by:
Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London
Image 3
Human Lung
WB Suggested Anti-CAV2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com