Product Number |
AVARP09020_P050 |
Product Page |
www.avivasysbio.com/cav2-antibody-n-terminal-region-avarp09020-p050.html |
Name |
CAV2 Antibody - N-terminal region (AVARP09020_P050) |
Protein Size (# AA) |
162 amino acids |
Molecular Weight |
18kDa |
NCBI Gene Id |
858 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Caveolin 2 |
Alias Symbols |
CAV |
Peptide Sequence |
Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sowa,G., (2008) Biochemistry 47 (1), 101-111 |
Description of Target |
CAV2 is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript. |
Protein Interactions |
EGFR; PTGS1; CSNK2A1; CAV1; MALL; KCNMA1; UBC; DNAJA1; GOLGB1; NCK1; SRC; RASA1; FLOT2; DRD1; PLD2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CAV2 (AVARP09020_P050) antibody |
Blocking Peptide |
For anti-CAV2 (AVARP09020_P050) antibody is Catalog # AAP30145 (Previous Catalog # AAPP00302) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CAV2 |
Uniprot ID |
P51636 |
Protein Name |
Caveolin-2 |
Publications |
Chi Sabins, N. et al. DLK1: a novel target for immunotherapeutic remodeling of the tumor blood vasculature. Mol. Ther. 21, 1958-68 (2013). 23896726 |
Protein Accession # |
NP_001224 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001233 |
Tested Species Reactivity |
Human |
Gene Symbol |
CAV2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
Image 1 | Human placental
| Sample Type: Human placental tissue Primary Antibody Dilution: 1:50Secondary Antibody: Goat anti rabbit-HRP Secondary Antibody Dilution: 1:10,000Color/Signal Descriptions: Brown: CAV2
Purple: HaemotoxylinGene Name: CAV2Submitted by: Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham |
|
Image 2 | Human placenta
| Lanes: Lane1: 50 ug human placental tissue lysate Lane2: 40 ug human placental tissue lysate Lane3: 30 ug human placental tissue lysate Lane4: 20 ug human placental tissue lysate Lane5: 20 ug human myometrial tissue lysate Primary Antibody Dilution: 1:500 Secondary Antibody: Goat anti-rabbit HRP Secondary Antibody Dilution: 1:10000 Gene Name: Caveolin 2 Submitted by: Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London
|
|
Image 3 | Human Lung
| WB Suggested Anti-CAV2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Lung |
|