CAV2 antibody - N-terminal region (AVARP09020_P050)
Data Sheet
Product Number AVARP09020_P050
Product Page
Product Name CAV2 antibody - N-terminal region (AVARP09020_P050)
Size 100 ul
Gene Symbol CAV2
Alias Symbols CAV, MGC12294
Protein Size (# AA) 162 amino acids
Molecular Weight 18kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 858
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Caveolin 2
Description This is a rabbit polyclonal antibody against CAV2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE
Target Reference Sowa,G., (2008) Biochemistry 47 (1), 101-111
Description of Target CAV2 is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.
Protein Interactions EGFR; PTGS1; CSNK2A1; CAV1; MALL; KCNMA1; UBC; DNAJA1; GOLGB1; NCK1; SRC; RASA1; FLOT2; DRD1; PLD2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CAV2 (AVARP09020_P050) antibody is Catalog # AAP30145 (Previous Catalog # AAPP00302)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CAV2
Complete computational species homology data Anti-CAV2 (AVARP09020_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CAV2.
Swissprot Id P51636
Protein Name Caveolin-2

Chi Sabins, N. et al. DLK1: a novel target for immunotherapeutic remodeling of the tumor blood vasculature. Mol. Ther. 21, 1958-68 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23896726

Protein Accession # NP_001224
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CAV2.
Nucleotide Accession # NM_001233
Replacement Item This antibody may replace item sc-7942 from Santa Cruz Biotechnology.
Conjugation Options

AVARP09020_P050-FITC Conjugated

AVARP09020_P050-HRP Conjugated

AVARP09020_P050-Biotin Conjugated

CB Replacement sc-7942
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Image 1
Human Lung
WB Suggested Anti-CAV2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
Image 2
Human placenta
Lane1: 50 ug human placental tissue lysate
Lane2: 40 ug human placental tissue lysate
Lane3: 30 ug human placental tissue lysate
Lane4: 20 ug human placental tissue lysate
Lane5: 20 ug human myometrial tissue lysate
Primary Antibody Dilution:
Secondary Antibody:
Goat anti-rabbit HRP
Secondary Antibody Dilution:
Gene Name:
Caveolin 2
Submitted by:
Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London
Image 3
Human placental
Sample Type :
Human placental tissue
Primary Antibody Dilution :
Secondary Antibody :
Goat anti rabbit-HRP
Secondary Antibody Dilution :
Color/Signal Descriptions :
Brown: CAV2 Purple: Haemotoxylin
Gene Name :
Submitted by :
Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 |